DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and Rad23a

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001365823.1 Gene:Rad23a / 19358 MGIID:105126 Length:367 Species:Mus musculus


Alignment Length:78 Identity:26/78 - (33%)
Similarity:47/78 - (60%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNI-QK 63
            |.:|||..:|..:.:||.:|::.:|.||:.::|   .|...|:||:|||.|.|...:.:|:| :|
Mouse     5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIKEYHIDEK 69

  Fly    64 ESTLHLVLRLRGG 76
            ...:.:|.:.:.|
Mouse    70 NFVVVMVTKAKAG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 25/76 (33%)
Ribosomal_S27 103..147 CDD:460261
Rad23aNP_001365823.1 rad23 3..365 CDD:273167 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..160 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.