DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and C16C8.14

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_494545.1 Gene:C16C8.14 / 173689 WormBaseID:WBGene00015852 Length:233 Species:Caenorhabditis elegans


Alignment Length:53 Identity:22/53 - (41%)
Similarity:28/53 - (52%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL 67
            |.|..||||..:|.:|....||.....|.....|.|||..||:.|||::.||:
 Worm   176 LRVCGSDTIRQIKPRINSLAGIDTISFRTFCDDKFLEDDHTLAHYNIREGSTI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 22/53 (42%)
Ribosomal_S27 103..147 CDD:460261
C16C8.14NP_494545.1 UBQ 170..228 CDD:214563 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.