DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdc2cAt

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_198758.2 Gene:cdc2cAt / 833938 AraportID:AT5G39420 Length:644 Species:Arabidopsis thaliana


Alignment Length:293 Identity:109/293 - (37%)
Similarity:178/293 - (60%) Gaps:13/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLES-DDEGVPSTAIREISLLKELKHENIVC 65
            |.|:|:||||:|||..|::.|...||::||:||::.:: ..|.:...| |||.:|::|.|.||:.
plant   103 EAFQKLEKIGQGTYSSVFRAREVETGKMVALKKVKFDNLQPESIRFMA-REILILRKLNHPNIMK 166

  Fly    66 LEDVLME--ENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRD 128
            ||.::..  .:.|||:||::..||.. :.|.|..:..|.: ::.|:.|:...:..||.|.|:|||
plant   167 LEGIVTSRASSSIYLVFEYMEHDLAG-LSSNPDIRFTEPQ-IKCYMKQLLWGLEHCHMRGVIHRD 229

  Fly   129 LKPQNLLIDKSGLIKVADFGLGRSFGIP--VRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIG 191
            :|..|:|::..|::|:.||||. :...|  ....|..:|||||||||:|:||..|...||:||:|
plant   230 IKASNILVNNKGVLKLGDFGLA-NVVTPSNKNQLTSRVVTLWYRAPELLMGSTSYGVSVDLWSVG 293

  Fly   192 CIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLT--NQLK 254
            |:|||:...||:.:|.:||:||.:::::..:|.:..|.. |.|| :..:|....|.:.|  .:.|
plant   294 CVFAEILMGKPILKGRTEIEQLHKIYKLCGSPQDSFWKR-TKLP-HATSFKPQHTYEATLRERCK 356

  Fly   255 NLDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            :|.|.|:.|::.:|..:|..|.:|...|...||
plant   357 DLSATGVYLLETLLSMEPDKRGTASSALNSEYF 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 106/290 (37%)
cdc2cAtNP_198758.2 STKc_CDK9_like 105..389 CDD:270832 106/289 (37%)
S_TKc 105..389 CDD:214567 106/289 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.