DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and MPK6

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_181907.1 Gene:MPK6 / 818982 AraportID:AT2G43790 Length:395 Species:Arabidopsis thaliana


Alignment Length:293 Identity:108/293 - (36%)
Similarity:161/293 - (54%) Gaps:20/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVLM 71
            |..||:|.||:|....|..|.:.||:|||....|::......:|||.||:.:.|||||.:.|::.
plant    66 IMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIP 130

  Fly    72 EE-----NRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKP 131
            ..     |.:|:.:|.:..||.:.:.|   ::.:..|..:.:||||...:.:.|...||||||||
plant   131 PPLRNAFNDVYIAYELMDTDLHQIIRS---NQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKP 192

  Fly   132 QNLLIDKSGLIKVADFGLGR-----SFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIG 191
            .|||::.:..:|:.||||.|     .|      .|..:||.||||||:||.|..|:..:|:||:|
plant   193 SNLLLNANCDLKICDFGLARVTSESDF------MTEYVVTRWYRAPELLLNSSDYTAAIDVWSVG 251

  Fly   192 CIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVT-SLPDYKNTFPCWSTNQLTNQLKN 255
            |||.|:..|||||.|...:.||..:..::.||:|:....:. :...|....|.:....:|::...
plant   252 CIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPT 316

  Fly   256 LDANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288
            :....||||:|||.:||..||:..|.|.|||.|
plant   317 VHPLAIDLIEKMLTFDPRRRITVLDALAHPYLN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 106/290 (37%)
MPK6NP_181907.1 STKc_TEY_MAPK 56..391 CDD:143363 108/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.