DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk12

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001103096.1 Gene:Cdk12 / 69131 MGIID:1098802 Length:1484 Species:Mus musculus


Alignment Length:301 Identity:114/301 - (37%)
Similarity:188/301 - (62%) Gaps:20/301 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ::.|:.|..|||||||.|||.:::.||::||:||:||:::.||.|.||||||.:|::|.|:::|.
Mouse   720 VDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVN 784

  Fly    66 LEDVL----------MEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCH 120
            :::::          .::...||:||::..||...::|..|  |...:.::|::.|:...:.:||
Mouse   785 MKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLV--HFSEDHIKSFMKQLMEGLDYCH 847

  Fly   121 RRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGI-PVRIYTHEIVTLWYRAPEVLLGSPRYSCP 184
            ::..||||:|..|:|::.||.||:|||||.|.:.. ..|.||::::|||||.||:|||..||:..
Mouse   848 KKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPA 912

  Fly   185 VDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQL 249
            :|:||.|||..|:.|:||:||.:.|:.||..:.|:..:|...:||.|..|| |.||..  ...|.
Mouse   913 IDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLP-YFNTMK--PKKQY 974

  Fly   250 TNQLKN----LDANGIDLIQKMLIYDPVHRISAKDILEHPY 286
            ..:|:.    :.:..:||:..||..||..|.:|:..|:..:
Mouse   975 RRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDF 1015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 114/299 (38%)
Cdk12NP_001103096.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..465
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..699
STKc_CDK12 715..1016 CDD:270847 114/301 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1156..1199
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1219..1363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1437..1484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.