DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Pak5

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_006499571.1 Gene:Pak5 / 241656 MGIID:1920334 Length:736 Species:Mus musculus


Alignment Length:285 Identity:72/285 - (25%)
Similarity:135/285 - (47%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCL 66
            |..:...|||||:.|:|.....:.||:.||:||:.|.....  ......|:.::::..|:|:|.:
Mouse   464 EYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQR--RELLFNEVVIMRDYHHDNVVDM 526

  Fly    67 EDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKP 131
            .:..:..:.::::.|||....   :..:.....|..|.:.:....:..|:.:.|.:.|:|||:|.
Mouse   527 YNSYLVGDELWVVMEFLEGGA---LTDIVTHTRMNEEQIATVCLSVLKALSYLHNQGVIHRDIKS 588

  Fly   132 QNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAE 196
            .::|:...|.||::|||........|......:.|.::.||||:...| |...|||||:|.:..|
Mouse   589 DSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLP-YGTEVDIWSLGIMVIE 652

  Fly   197 MATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANGI 261
            |...:|.:..:..: |..|..|      :.:.|.|..|            :::::.|:..    :
Mouse   653 MIDGEPPYFNEPPL-QAMRRIR------DSLPPRVKDL------------HKVSSMLRGF----L 694

  Fly   262 DLIQKMLIYDPVHRISAKDILEHPY 286
            ||   ||:.:|..|.:|:::|.||:
Mouse   695 DL---MLVREPSQRATAQELLGHPF 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 71/284 (25%)
Pak5XP_006499571.1 CRIB_PAK_like 26..72 CDD:238526
STKc_PAK5 443..734 CDD:132989 72/285 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.