DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and AgaP_AGAP002986

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_311901.5 Gene:AgaP_AGAP002986 / 1272970 VectorBaseID:AGAP002986 Length:794 Species:Anopheles gambiae


Alignment Length:283 Identity:70/283 - (24%)
Similarity:129/283 - (45%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLED 68
            :.|:||||:|..|.||......||..||:|::.|....:  ....|.||.:::|.||.|:|...|
Mosquito   520 YNKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPK--KELIINEILVMRENKHPNVVNYLD 582

  Fly    69 VLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQN 133
            ..:....::::.|:|.   ...:..:..:..|:...:.:...::..|:.|.|..:|:|||:|..|
Mosquito   583 SYLVSEELWVVMEYLP---GGSLTDVVTETCMDEGQIAAVCREVLQALEFLHSNQVIHRDIKSDN 644

  Fly   134 LLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMA 198
            :|:...|.:|:.|||............|..:.|.::.||||:. ..:|...||:||:|.:..||.
Mosquito   645 ILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVT-RKQYGPKVDLWSLGIMAIEMI 708

  Fly   199 TRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANGIDL 263
            ..:|.:..::.:..|:    ::.|..:         |:.|             :.:.|.....|.
Mosquito   709 EGEPPYLNENPLRALY----LIATHGK---------PEIK-------------EKEKLSTVFQDF 747

  Fly   264 IQKMLIYDPVHRISAKDILEHPY 286
            :.:.|..|...|.:|.::|.||:
Mosquito   748 LDQCLEVDVDQRATAYELLRHPF 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 70/283 (25%)
AgaP_AGAP002986XP_311901.5 CRIB_PAK_like 83..128 CDD:238526
STKc_PAK_I 512..772 CDD:270814 70/283 (25%)
S_TKc 520..771 CDD:214567 70/283 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.