DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and nlk.2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_031748355.1 Gene:nlk.2 / 100144684 XenbaseID:XB-GENE-1218923 Length:456 Species:Xenopus tropicalis


Alignment Length:307 Identity:105/307 - (34%)
Similarity:162/307 - (52%) Gaps:37/307 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVL---- 70
            ||.|.:|||:...:...|:.||:||:.....:........||:.:|...||:|::...|:|    
 Frog    73 IGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPQ 137

  Fly    71 ---MEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQ 132
               .||  ||:|.|.:..||.|.:.|   .:.:.|:.::.:||||...:.:.|...:||||:||.
 Frog   138 IDCFEE--IYVITELMQTDLHKVIVS---PQPLSSDHIKVFLYQILRGLKYLHSAGILHRDIKPG 197

  Fly   133 NLLIDKSGLIKVADFGLGRSFGIPVRIY-THEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAE 196
            |||::.:.::|:.||||.|...:....: |.|:||.:|||||:|:||..|...:||||:||||||
 Frog   198 NLLVNSNCVLKICDFGLARVEELDESQHMTQEVVTQYYRAPEILMGSRHYRSAIDIWSVGCIFAE 262

  Fly   197 MATRKPLFQGDSEIDQLFRMFRILKTP------------TEDIWPGVTSLPDYKNTFPCWSTNQL 249
            :..|:.|||..|.|.||..:..:|.||            ...|..|....|.....:  ..:.:.
 Frog   263 LLGRRILFQAQSPIQQLDLITDLLGTPPLTAMRSACEGARAHILRGPHKPPSLSVLY--MLSGEA 325

  Fly   250 TNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQSGLVR 296
            |::       .:.|:.:||::||:.||||||.|.|||   .:.|.:|
 Frog   326 THE-------AVHLLCRMLLFDPLKRISAKDALAHPY---LEEGRLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 102/296 (34%)
nlk.2XP_031748355.1 STKc_NLK 66..437 CDD:173748 105/307 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.