powered by:
Protein Alignment Cdk1 and camkk1
DIOPT Version :9
Sequence 1: | NP_476797.1 |
Gene: | Cdk1 / 34411 |
FlyBaseID: | FBgn0004106 |
Length: | 297 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001093741.1 |
Gene: | camkk1 / 100101776 |
XenbaseID: | XB-GENE-490615 |
Length: | 170 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 11/42 - (26%) |
Similarity: | 19/42 - (45%) |
Gaps: | 14/42 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDE 42
:..::...:||:|:||||....| :|||:
Frog 137 LNQYKLQSEIGKGSYGVVKLAYN--------------QSDDK 164
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.