DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and ALG8

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_014710.1 Gene:ALG8 SGDID:S000005593 Length:577 Species:Saccharomyces cerevisiae

Alignment Length:501 Identity:120/502 (24%)
Similarity:197/502 (39%) Gaps:149/502 (30%)


  Fly    35 DYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWGLDYPPLTAYHSYL------------------- 80
            |::..|:|..||..|.:.|||...::.    |.|||||..||..:.                   
Yeast    66 DFDVHRNWLAITNKLPISEWYYEHTSQ----WTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIVE 126

  Fly    81 VGRIGASIDPRFVELHKSRGFESKEHKRFMRATVVSADVLIYLPAMLLLAYSLDKAFRSDDKLFL 145
            :|:.|.   |..|               |.|.||:.:::|:::  :|.:..:..|.........:
Yeast   127 IGKFGL---PTIV---------------FQRLTVIFSEILLFV--ILQIYINTTKLSERSQSFVV 171

  Fly   146 FTLVAAYPGQTLIDNGHFQYNNISLGFAAVAIAAILRRRFYAAAFFFTLALNYKQMELYHSLPFF 210
            .:.:...||..:||:.|||||.........:|.|...:|:...|..:|.|:.:|.:.||.:..:|
Yeast   172 ASSIVLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYF 236

  Fly   211 AFLLGECVSQ------KSFASFI-----AEISRIAAVVLGTFAILWVPWLGSLQAVLQVLHRLFP 264
            .|||...|..      ||:..|:     |.:.::|.||:|.|.|.::|:...:.   |||.||||
Yeast   237 VFLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPFAHQMP---QVLSRLFP 298

  Fly   265 VARGV--------------FEDKVANVWCAVNVVWKLK-------------------KHISNDQM 296
            .:||:              |.||:     ...|:.||.                   |.| |:::
Yeast   299 FSRGLTHAYWAPNFWALYSFMDKI-----LTTVMLKLPYVHTFATKFIKPPLIPQNIKEI-NERL 357

  Fly   297 A---------------------------LVCIACTLIASLPTNVLL----FRRRTNVGFLLALFN 330
            |                           ::.|...::|.||   ||    |:|     |:.:|..
Yeast   358 AANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLP---LLFDPSFKR-----FVGSLTL 414

  Fly   331 TSLAFFLFSFQVHEKTILLTALPALFLLKCWPDEMILFLEVT---VFSMLPLLAR-DELLVPAVV 391
            ..||.|||.:.||||.|:|..:|..||:......::.|:.|.   ..|:.|||.: .:..:..:.
Yeast   415 CGLASFLFGWHVHEKAIMLVIIPFTFLVGFDRRLLVPFMLVASAGYVSLYPLLYKGQDFFIKTLY 479

  Fly   392 ATVAFHLIFKCFDSKSKLS----------NEYPLKYIANISQILMI 427
            ..|...:.|..|...:|:|          :...|.||.::..|:.:
Yeast   480 TYVWCIIYFAAFRKTTKISSSVERRIFFLDRLALTYIFSLLPIVTV 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 120/502 (24%)
ALG8NP_014710.1 Alg6_Alg8 52..562 CDD:308661 120/502 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.741681 Normalized mean entropy S1324
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.