DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and ALG6

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_014644.1 Gene:ALG6 SGDID:S000005528 Length:544 Species:Saccharomyces cerevisiae

Alignment Length:499 Identity:190/500 (38%)
Similarity:279/500 (56%) Gaps:52/500 (10%)


  Fly    15 VRSIISLYSYSGFDSPPMHGDYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWGLDYPPLTAYHSY 79
            :|..|.|..|||..|||::||:||||||.|||.:|.:.:||.    .||||||||||||||:|||
Yeast    49 LRCTIGLGPYSGKGSPPLYGDFEAQRHWMEITQHLPLSKWYW----YDLQYWGLDYPPLTAFHSY 109

  Fly    80 LVGRIGASIDPRFVELHKSRGFESKEH--KRFMRATVVSADVLIYLPAMLLLAYSLDKAFRSDDK 142
            |:|.||:..:|.:..|.|||||||.::  |.:||:||:.:|:|.|.||::.....|.: :|:...
Yeast   110 LLGLIGSFFNPSWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGR-YRNQSP 173

  Fly   143 L---FLFTLVAAYPGQTLIDNGHFQYNNISLGFAAVAIAAILRRRFYAAAFFFTLALNYKQMELY 204
            :   ...:.:...|...|||:||||||::.||..|.||..:|...:..||..|.|::.:|||.||
Yeast   174 IGQSIAASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALY 238

  Fly   205 HSLPFFAFLLGECVSQKSFASF-IAEISRIAAVVLGTFAILWVPWL---GSLQAVLQVLHRLFPV 265
            ::..|||:||...:   .|..| ||.::.||...|.||||::.|..   |.|:.:.|.:||:||.
Yeast   239 YAPIFFAYLLSRSL---LFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPF 300

  Fly   266 ARGVFEDKVANVWCAVNVVWKLKKHISNDQMALVCIACTLIASLPTNV--LLFRRRTNVGFLLAL 328
            |||:|||||||.||..||..|.|:..:..|:.|..:..|:|..||..:  ||..::..:.::  |
Yeast   301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYV--L 363

  Fly   329 FNTSLAFFLFSFQVHEKTILLTALPALFLLKCWPDEMILFL-----EVTVFSMLPLLARDELLVP 388
            ...|::||||||||||||||:..|| :.||....|..:|.|     .|.:|::.|||.:|.|.:.
Yeast   364 IACSMSFFLFSFQVHEKTILIPLLP-ITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQ 427

  Fly   389 AVVATVAFHLIFKCFD---------------SKSKLSNEYPLKYIANISQI---LMISVVVA--- 432
            ..|:.:..:.:...|.               |.|.::::|..:.:...:.:   .:|...:|   
Yeast   428 YAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGF 492

  Fly   433 ----SLTVPAPTKYPDLWPLIISVTSCGHFFLFFLWGNVQQFSS 472
                ...|..|:||||||.|:........|.:|:||...:.|:|
Yeast   493 YHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTS 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 179/474 (38%)
ALG6NP_014644.1 Alg6_Alg8 64..528 CDD:281190 180/475 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262284247
eggNOG 1 0.900 E1_KOG2575
Hieranoid 1 1.000
Homologene 1 1.000 H6920
Inparanoid 1 1.050 298 1.000 Inparanoid score I505
Isobase 1 0.950 0.741681 Normalized mean entropy S1324
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004506
OrthoInspector 1 1.000 T1136468
orthoMCL 1 0.900 OOG5_130031
Panther 1 1.100 LDO PTHR12413
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R44
TreeFam 1 0.960
1312.830

Return to query results.
Submit another query.