DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and AT5G38460

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001190434.1 Gene:AT5G38460 AraportID:AT5G38460 Length:533 Species:Arabidopsis thaliana

Alignment Length:483 Identity:193/484 (40%)
Similarity:271/484 (56%) Gaps:18/484 (4%)


  Fly     3 SEILASAFLGLAVRSIISLYSYSGFDSPPMHGDYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWG 67
            :..|..:...|.:||.:::|.|||...||..||:||||||.|||.||.|.:||.|.:.|||.|||
plant    40 TSFLCISLFALLIRSAVTMYPYSGAGIPPKFGDFEAQRHWMEITTNLPVIDWYRNGTYNDLTYWG 104

  Fly    68 LDYPPLTAYHSYLVGRIGASIDPRFVELHKSRGFESKEHKRFMRATVVSADVLIYLPAML--LLA 130
            |||||||||.||:.|......:|..|.|..|||.||...|..||.||:|:|..|:.||.|  :|.
plant   105 LDYPPLTAYQSYIHGIFLRFFNPESVALLSSRGHESYLGKLLMRWTVLSSDAFIFFPAALFFVLV 169

  Fly   131 YSLDKAFRSDDKL-FLFTLVAAYPGQTLIDNGHFQYNNISLGFAAVAIAAILRRRFYAAAFFFTL 194
            |..::......:: :...::...|...|||:||||||.||||....||||:|..........|:|
plant   170 YHRNRTRGGKSEVAWHIAMILLNPCLILIDHGHFQYNCISLGLTVGAIAAVLCESEVLTCVLFSL 234

  Fly   195 ALNYKQMELYHSLPFFAFLLGECVSQKSFASFIAEISRIAAVVLGTFAILWVPWLGSLQAVLQVL 259
            ||::|||..|.:..||:.|||:|:.:|   |.|..:.::...|:.||.|.|.|::.||...|.||
plant   235 ALSHKQMSAYFAPAFFSHLLGKCLRRK---SPILSVIKLGIAVIVTFVIFWWPYVHSLDDFLMVL 296

  Fly   260 HRLFPVARGVFEDKVANVWCAVNVVWKLKKHISNDQMALVCIACTLIASLPTNVLLFRRRTNVGF 324
            .||.|..||::||.|||.||..:::.|.|...:...:..:.:|.|::||||:.|......:|.||
plant   297 SRLAPFERGIYEDYVANFWCTTSILIKWKNLFTTQSLKSISLAATILASLPSMVQQILSPSNEGF 361

  Fly   325 LLALFNTSLAFFLFSFQVHEKTILLTALPALFLLKCWPDEMILFLEVTVFSMLPLLARDELLVPA 389
            |..|.|:|:||:|||||||||:||:..|.|..|....||.........:|||.|||.||:||:|.
plant   362 LYGLLNSSMAFYLFSFQVHEKSILMPFLSATLLALKLPDHFSHLTYYALFSMFPLLCRDKLLIPY 426

  Fly   390 VVATVAFHLIFKCFDS-----KSKLS----NEYPLKYIANISQILMISVV--VASLTVPAPTKYP 443
            :..:..|.:|:....:     |:.:|    ..:| .|:..:.....||||  |..||:..|.|||
plant   427 LTLSFLFTVIYHSPGNHHAIQKTDVSFFSFKNFP-GYVFLLRTHFFISVVLHVLYLTIKPPQKYP 490

  Fly   444 DLWPLIISVTSCGHFFLFFLWGNVQQFS 471
            .|:..:|.:....:|.:|..:.|..|::
plant   491 FLFEALIMILCFSYFIMFAFYTNYTQWT 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 183/447 (41%)
AT5G38460NP_001190434.1 Alg6_Alg8 66..507 CDD:281190 182/445 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6920
Inparanoid 1 1.050 327 1.000 Inparanoid score I670
OMA 1 1.010
OrthoDB 1 1.010 D595382at2759
OrthoInspector 1 1.000 T192304
orthoMCL 1 0.900 OOG5_130031
Panther 1 1.100 LDO PTHR12413
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.