DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and AT2G44660

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_181994.5 Gene:AT2G44660 AraportID:AT2G44660 Length:506 Species:Arabidopsis thaliana

Alignment Length:484 Identity:122/485 (25%)
Similarity:211/485 (44%) Gaps:72/485 (15%)


  Fly    35 DYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWGLDYPPLTAYHSYLVGRIGASIDPRFVELHKSR 99
            |:|..|:|..||.:|.:.:||.:.::.    |.|||||..||....:......:|||.|:|....
plant    34 DFEVHRNWLAITNSLPLTKWYFDETSQ----WTLDYPPFFAYFERFLSIFARLVDPRIVDLQSGL 94

  Fly   100 GFESKEHKRFMRATVVSADVLIYLPAMLLLAYSLDKAFRSDDKLFLFTLVAAYPGQTLIDNGHFQ 164
            .:.::....|.|.:|:.:|:     .:|...|.|.:......:..:..||...||..::|:.|||
plant    95 DYNAESVIYFQRISVIVSDL-----CLLYGVYRLTRKLEPLKRNLICALVIWSPGLLIVDHIHFQ 154

  Fly   165 YNNISLGFAAVAIAAILRRRFYAAAFFFTLALNYKQMELYHSLPFFAFLLGE-CVSQKSFASFIA 228
            ||...||:..::|:.:...|.....|.|.:.|.:|.:....:..:|.:||.. |.|  ...:...
plant   155 YNGFLLGWLLLSISFLQEGRDLLGGFLFAVLLCFKHLFAVTAPVYFVYLLRHYCWS--GLVTGFR 217

  Fly   229 EISRIAAVVLGTFAILWVPWL--GSLQAVLQVLHRLFPVARGVFEDKVA-NVWCAVNVVWK---- 286
            .:..|.|||:..||..:.|::  |.:|   ||:.|:||..||:.....| |.|....::.|    
plant   218 RLVTIGAVVVAVFAAAYGPFIYHGQIQ---QVISRMFPFGRGLCHAYWAPNFWVFYIILDKGLAV 279

  Fly   287 -LKKHISNDQM-----------------------ALVCIACTLIASLPTNVLLFRRRTNVGFLLA 327
             |:|.....|:                       .|...|..|:|..|..:..: ::.:.| |:|
plant   280 LLRKLGYEIQIPSASFTGGLVGDSSPFAVLPQITPLTTFAMVLLAISPCLIKAW-KKPHSG-LVA 342

  Fly   328 LFNTSLAF---FLFSFQVHEKTILLTALP-ALFLLKCWPDEMILFLE--VTVFSMLPLLARDE-- 384
            .: .:.|:   |||.:.||||..|...:| |:..::...|....||.  |:.:|:.|||...:  
plant   343 RW-VAYAYTCGFLFGWHVHEKASLHFTIPLAIVAVQSLEDAKHYFLVSIVSCYSLYPLLYEPQEY 406

  Fly   385 ------LLVPAVVATVAFHLIFKCFDSKSKLSNEYPLKYIANISQI-----LMISVVVASLTVP- 437
                  ||:.:||..:.|...:..:.::.|.::|...|:.....:.     |:|..:|:....| 
plant   407 PIKVLLLLLHSVVMWLGFAAQYTDYKAQKKETSEIKSKFRIGCFEKSYLMGLIIVEIVSQFLHPY 471

  Fly   438 -APTKYPDLWPLIISVTSCGHFFLF-FLW 464
             ...|.|.| ||::..|.|....:: ::|
plant   472 FLGDKLPFL-PLMLISTYCTVGIMYSWIW 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 121/482 (25%)
AT2G44660NP_181994.5 Alg6_Alg8 19..499 CDD:281190 121/483 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D595382at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.