DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and alg8

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001076820.1 Gene:alg8 XenbaseID:XB-GENE-967047 Length:542 Species:Xenopus tropicalis

Alignment Length:513 Identity:133/514 (26%)
Similarity:217/514 (42%) Gaps:93/514 (18%)


  Fly    30 PPMHG-DYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWGLDYPPLTAYHSYLVGRIGASIDPRFV 93
            |..|. |:|..|:|..||.:|.|.:||..:::.    |.|||||..|:..:|:.::...:||..:
 Frog    45 PTYHSTDFEVHRNWLAITHSLPVSKWYYEATSE----WTLDYPPFFAWFEHLLAKVAQYVDPEML 105

  Fly    94 ELHKSRGFESKEHKRFMRATVVSADVL-IYLPAMLLLAYSLDKAFRS--DDKLFLFTLVAAYP-G 154
            :: ::..:.|:|...|.|.:|:..|:| ||..:......:..|..|.  ....|:..::..:. |
 Frog   106 KV-ENLNYASQETVLFQRLSVIITDILFIYAASQCCKCVNGRKDRRDLIQKPAFVLAVLLLWNFG 169

  Fly   155 QTLIDNGHFQYNNISLGFAAVAIAAILRRRFYAAAFFFTLALNYKQMELYHSLPFFAFLL-GEC- 217
            ..::|:.|||||....|...::||.:.::|...:||.|.:.||:|.:.||.:..:..::| ..| 
 Frog   170 LLIVDHIHFQYNGFLSGIMLLSIARLYQKRVMESAFLFAVLLNFKHIYLYIAPAYGMYMLRSYCF 234

  Fly   218 --------VSQKSFASFIAEISRIAAVVLGTFAILWVP--WLGSLQAVLQVLHRLFPVARGVFED 272
                    |..:||:..  .:..:...|...||:.:.|  :||.|.   |||.||||..||:...
 Frog   235 TGNNPDGSVRWRSFSCL--RLLSLGLTVCSVFALSFGPFVYLGQLP---QVLSRLFPFKRGLCHA 294

  Fly   273 KVA-NVWCAVNVVWK-----------------------------LKKHISNDQMALVCIACTLIA 307
            ..| |.|...|:|.|                             .:..:......:..:.|||::
 Frog   295 YWAPNFWALYNMVDKALSIIGVKLQLLDPATIRTGTMTRGLVQEFEHSVLPSVTPMATLVCTLVS 359

  Fly   308 SLPTNVLLFRR-RTNVGFLLALFNTSLAFFLFSFQVHEKTILLTALPALFLLKCWPDEMILFLEV 371
            .||:.:.|:|: :...|||..|...:|..|:|.:.||||.|||..||...|......:..:||.:
 Frog   360 ILPSVLRLWRKPQGPTGFLRCLILCALGSFMFGWHVHEKAILLAILPLSILSVTSAKDAGIFLVL 424

  Fly   372 TV---FSMLPLLARDELLVPAVVATVAFHLIFKCFD---SKSKLSNEYPL------KYIANISQI 424
            ..   ||:.|||    ...|.:...|...|||..|.   .::....|..|      .|:..:..:
 Frog   425 ATTGHFSLFPLL----FTAPELPIKVLLMLIFTVFSVSALRAMFQRERALLSWVETLYLCGLVPL 485

  Fly   425 LMISVVVASLTVPAPTKYPDLW-------PLIISVTSCGHFFLFFLWGNVQQFSSKLS 475
            .....||..||         .|       ||::|...|. ..:.:.|..:  :.|.||
 Frog   486 GAFCEVVYPLT---------SWHQQLPFVPLLLSSGYCA-LGVTYSWARL--YISALS 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 129/500 (26%)
alg8NP_001076820.1 Alg6_Alg8 36..522 CDD:308661 129/501 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.