DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and xit

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster

Alignment Length:495 Identity:143/496 (29%)
Similarity:223/496 (45%) Gaps:69/496 (14%)


  Fly    30 PPMHG-DYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWGLDYPPLTAYHSYLVGRIGASIDPRFV 93
            |..|. |:|..|:|..||.:|.:.:||.::::.    |.|||||..||..:|:.::...:|||.:
  Fly    21 PAYHSTDFEVHRNWLAITHSLPLNQWYVDATSE----WTLDYPPFFAYFEWLLSQVAKYVDPRML 81

  Fly    94 ELHKSRGFESKEHKRFMRATVVSADVLIYLPAMLLLAYSLDKAFRSDDKLFLFT-LVAAYPGQTL 157
            .: .:..:|||....|.|.:|:..| |:|:..:.....||... |...:.|..: |:....|...
  Fly    82 VV-DNLNYESKATVYFQRLSVIVTD-LVYVLGVRSCLGSLGLG-RDTQQFFAASMLLLLNVGLIF 143

  Fly   158 IDNGHFQYNNISLGFAAVAIAAILRRRFYAAAFFFTLALNYKQMELYHSLPFFAFLLG-ECVSQK 221
            :|:.|||||.:..|...::|.:::|:||..:||.|.:.||:|.:.||.:..|..:||. .|:.|.
  Fly   144 VDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKHIFLYMAPAFGVYLLRFYCLEQA 208

  Fly   222 SFASFIAEISRIAAVVLGTFAILWVP-WLGSLQAVLQVLHRLFPVARGVFEDKVA-NVWCAVNVV 284
            |..|.:..:.::..|.|..||:.:.| |    |.:.|||.||||..||:.....| |.|...|..
  Fly   209 SVVSAVGAVVKLLVVGLTPFAVSFGPFW----QQLPQVLSRLFPFKRGLTHAYWAPNFWALYNAA 269

  Fly   285 WKLKKHISNDQ----------------------MALVCIACTLIASLPTNVLLFR---RRTNVGF 324
            .||...:...|                      ...|..|.|.:..||..|.|||   :::.:.|
  Fly   270 DKLAAGVLKVQDGGASTTSGLVQEVRHSVLPAITPPVTFALTALFMLPILVKLFRSAKKQSPLVF 334

  Fly   325 LLALFNTSLAFFLFSFQVHEKTILLTALPALFLLKCWPDEMILFLEVT----VFSMLPLLARDEL 385
            |.|:.....:.|:|.:.||||.||:..|| |.||.....|...:..|.    .||:.|||...:|
  Fly   335 LRAVVLCGCSSFVFGWHVHEKAILMVLLP-LCLLTLVNREDARYAYVLGIAGYFSLFPLLFDADL 398

  Fly   386 LVPAVVATVAF--------HLIFKCFDSKSKLSNEYPLKYIANISQILMISVVVASLTVPAPTKY 442
            .:|.....:::        :.||..|.....|...|.|.::|     :.:...:.|..:....:.
  Fly   399 YIPRYSLYMSYVAMMYGQLYRIFPGFRGFHTLEWLYMLGFMA-----IPLYEHLLSFLLHLDQRL 458

  Fly   443 PDLWPLIISVTSC-------GHFFLFFL---WGNVQQFSS 472
            |.|..|:.||.|.       |.::|:.|   ||.|...||
  Fly   459 PFLPLLLTSVYSALGVLYFFGAYYLYALGISWGKVPIASS 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 137/482 (28%)
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 135/474 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262851463
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.741681 Normalized mean entropy S1324
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12413
RoundUp 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.