DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gny and algn-8

Sequence 1:NP_001260338.1 Gene:gny FlyBaseID:FBgn0032234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001021940.2 Gene:algn-8 WormBaseID:WBGene00007464 Length:766 Species:Caenorhabditis elegans

Alignment Length:484 Identity:123/485 (25%)
Similarity:210/485 (43%) Gaps:89/485 (18%)


  Fly    11 LGLAVRSIISLYSYSGFDSPP-MHGDYEAQRHWQEITVNLAVGEWYTNSSNNDLQYWGLDYPPLT 74
            |.|||.:|  |.|:.....|. :..|:|..|:|..:|....:.||||.:::.    |.|||||..
 Worm     6 LVLAVTAI--LISFKCLLIPAYVSTDFEVHRNWMAVTWQRPLCEWYTEATSE----WTLDYPPFF 64

  Fly    75 AYHSYLVGRIG----------ASIDPRFVELHKSRGFESKEHKRFMRATVVSADVLIYLPAMLLL 129
            ||....:..:.          .|..|||          |:....|.|.:|:..|:| |:....|.
 Worm    65 AYFELGLASVAHFFGFDECLVISKTPRF----------SRRILIFQRFSVIFCDIL-YIAVCALY 118

  Fly   130 AY-------SLDKAFRSDDKLFLFTLVAAYPGQTLIDNGHFQYNNISLGFAAVAIAAILRRRFYA 187
            ::       .:.|..:.:.:...|.|:|:.....:.|:.|||||::......:::..|...|:..
 Worm   119 SFRSPRLVSRIPKKLQQNGREACFVLLASLQALIICDSIHFQYNSMLTAIFLMSLFFIDTERYLM 183

  Fly   188 AAFFFTLALNYKQMELYHSLPFFAFLLGECVSQKSFASFIAEISRIAAVVLGTFAILWVPWLGSL 252
            ||..:::.||:|.:.:|::|.:..:.|   |:...|:..:...:...|:.| ..|:| :|:..|:
 Worm   184 AALSYSILLNFKHIYVYYALGYVFYYL---VNYFQFSGNVLLANTPKAISL-AIALL-IPFCASI 243

  Fly   253 ---------QAVLQVLHRLFPVARGVFEDKVA-NVW--------CAVNVVWKLK----------- 288
                     |.:..:..|||||:||:.....| |.|        |...|:..||           
 Worm   244 FPFIHASGVQGLQNIATRLFPVSRGLTHAYWAPNFWALYNFADLCLYRVLSLLKIGKFDAPTYTS 308

  Fly   289 ------KH--ISN-DQMALVCIACTLIASLPTNVLLFRRRTNVGFLLALFNTSLAFFLFSFQVHE 344
                  .|  :.| ..|..:|:. .:.:.:....|:.||:.:..|.|....::..||.|.:.|||
 Worm   309 GLVQEYSHSVLPNVSPMGTLCLV-VISSMIVLTGLVIRRKDSADFSLFAVFSAFCFFYFGYHVHE 372

  Fly   345 KTILLTALP-ALFLLKCWPDEMILFLEVTV---FSMLPLLAR--DELLVPAVVATVAF-HLIFKC 402
            |.|:|..:| .:|.:|. |....:.:.:|.   ||:.|||..  :.||..|:..:..| .|:|..
 Worm   373 KAIILVTVPMTVFAIKN-PKYHSILIHLTCIASFSLFPLLFTPFETLLKYAICVSYFFIQLVFLK 436

  Fly   403 FDSKSKLSNEYPLKYIANISQILMISVVV 431
            ..:...||:..|.:::|  |.:||..|.|
 Worm   437 RVTLMPLSDLIPTRHVA--SWLLMGMVEV 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gnyNP_001260338.1 Alg6_Alg8 30..463 CDD:281190 116/466 (25%)
algn-8NP_001021940.2 Alg6_Alg8 15..496 CDD:281190 117/474 (25%)
Endonuclease_V 513..753 CDD:143472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.741681 Normalized mean entropy S1324
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.