DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr19 and dpr10

Sequence 1:NP_001260336.1 Gene:dpr19 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster

Alignment Length:313 Identity:82/314 (26%)
Similarity:127/314 (40%) Gaps:112/314 (36%)


  Fly    45 KNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSL 109
            :|.|.::   |..|.|.|.||.....||:|||.:|..:||||..|:::|:||...:.|.:..|:|
  Fly    61 RNITSLV---GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTL 122

  Fly   110 RIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAV------------------------------ 144
            :||..::.|.|.||||:|..|.:|..:.|.||:.:                              
  Fly   123 QIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187

  Fly   145 ----------------AEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGG 193
                            |.|...|:|::|:.||:.|.|.:|.:.|.|..:||||..|:::.::.||
  Fly   188 EFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG 252

  Fly   194 FVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQ 258
            .:            :|          .|:..|.:.                              
  Fly   253 RL------------KF----------KTIKSEETK------------------------------ 265

  Fly   259 HQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQ 311
                       |:|.:...:..|:|.|:|.|||...|||.||||:||:..|||
  Fly   266 -----------SILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQ 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 31/77 (40%)
IGc2 55..125 CDD:197706 30/70 (43%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 33/83 (40%)
IG_like 210..297 CDD:214653 34/150 (23%)
IGc2 217..287 CDD:197706 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.