DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lft and lix1

DIOPT Version :8

Sequence 1:NP_001188775.1 Gene:lft / 34405 FlyBaseID:FBgn0032230 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002933479.1 Gene:lix1 / 100497418 XenbaseID:XB-GENE-976693 Length:281 Species:Xenopus tropicalis

Alignment Length:257 Identity:146/258 (57%)
Similarity:190/258 (74%) Gaps:6/258 (2%)


  Fly    12 PTVTGFYEDRDYRVNVVEALQEFWQMKQSRGAELKNGALVIYESIPSNSQPYICFVTLPGGSCFG 76
            ||:  .::|    :|||..|||||:.|:.|.|...:.:||.|||:||...|::|:||||||||||
 Frog    21 PTI--IFKD----LNVVALLQEFWENKEKRRAVFPSESLVAYESVPSPDPPFVCYVTLPGGSCFG 79

  Fly    77 SFQNCPTKAEARRSSAKIALMNSVFNEHPSRRISDEFIQKAVQDARTSFKGTSQINEGTESGIGA 141
            :||.|.::|||||.:||:||:||:|||.|||||:.:||.|:||:|.:|..|.....:...:.:||
 Frog    80 NFQCCLSRAEARRDAAKVALLNSLFNELPSRRITTDFIMKSVQEAVSSTSGNILDADDPSTSVGA 144

  Fly   142 FRFMLEANKGRTMLEFQELMTVFQLLHWNGSLKAMRERHCSRQEVVAHYSNRSLDDEMRSQMALD 206
            :.:|||.|.|:|||||||||.|||||||||||||:||..||||||:|:||..|||:.|||.||||
 Frog   145 YHYMLETNVGKTMLEFQELMIVFQLLHWNGSLKALRETKCSRQEVIAYYSQYSLDERMRSHMALD 209

  Fly   207 WIAREHDNPGVIRRELVLAERELETFRMAGRELRFPKEKKDILMIAHNQLGGSALNSATIDD 268
            ||.:|.:.||:|.:||.||.||||..|.|||||||.||||:||.:|.:.:.|..:.|:.|.|
 Frog   210 WIMKEEEAPGIISQELQLALRELEESRKAGRELRFYKEKKEILGLALSHIYGDCITSSRIPD 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lftNP_001188775.1 LIX1 24..255 CDD:291615 139/231 (60%)
lix1XP_002933479.1 LIX1 17..258 CDD:291615 142/243 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225601020
eggNOG 1 0.900 E1_2CB0Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1026341at2759
OrthoFinder 1 1.000 FOG0003073
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.