DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5045 and Clpp

Sequence 1:NP_001260332.1 Gene:CG5045 FlyBaseID:FBgn0032229 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_059089.1 Gene:Clpp MGIID:1858213 Length:272 Species:Mus musculus

Alignment Length:244 Identity:150/245 (61%)
Similarity:182/245 (74%) Gaps:18/245 (7%)


  Fly     4 TAVSRFLQISSVQCGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISS 68
            ||||    .|.::......:.|...|||:||||||||||||||:||||:|||:|:||.|.|.::|
Mouse    33 TAVS----CSPLRRSLHGTATRAFPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVAS 93

  Fly    69 TVVAQLLFLQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAG 133
            .|:|||||||||:..||||:|||||||||||||||||||||:..||.|||||||.||||||||||
Mouse    94 LVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAG 158

  Fly   134 APGMRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMSGRMERD 198
            :||||:||||:|||||||||||:||||||.|.||||:|:|:||.|||.||.|.:.:.:...||||
Mouse   159 SPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERD 223

  Fly   199 HFMTPEEAKVLGIIDHVLEHPPETVSETGPASDGGVTSGKAVPEECEKK 247
            .:|:|.||:..||:|.||.|||:              .|:..||..:|:
Mouse   224 RYMSPMEAQEFGILDKVLVHPPQ--------------DGEDEPELVQKE 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5045NP_001260332.1 clpP 28..222 CDD:178955 140/194 (72%)
ClppNP_059089.1 clpP 53..245 CDD:178955 139/192 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C233529671
eggNOG 1 0.900 E1_COG0740
Hieranoid 1 1.000
Homologene 1 1.000 H4385
Inparanoid 1 1.050 293 1.000 Inparanoid score I2736
Isobase 1 0.950 0 Normalized mean entropy S2542
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006452
OrthoInspector 1 1.000 T1084448
orthoMCL 1 0.900 OOG5_127187
Panther 1 1.100 LDO PTHR10381
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2456
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.