DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5367 and CG6337

Sequence 1:NP_609387.1 Gene:CG5367 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001286395.1 Gene:CG6337 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster

Alignment Length:377 Identity:90/378 (24%)
Similarity:156/378 (41%) Gaps:84/378 (22%)


  Fly     1 MWKLIFFGCLCGLNCQIVTSN----LSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFE 61
            |:||:    ||   |.::|.:    .:.|..     ..:|:.:::|.|:.|..|.....:...|.
  Fly     1 MFKLL----LC---CLLLTIDSGWAFNHGQD-----LVDFQTYEDNFNKTYASTSARNFANYYFI 53

  Fly    62 ENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMAN 126
            .|...:.:||......:|::|...|.|:|          :||::                 ..|.
  Fly    54 YNRNQVAQHNAQADRNRTTYREAVNQFSD----------IRLIQ-----------------FAAL 91

  Fly   127 VPESLDWRSKGFITPPYNQ----------------------LSCGSCYAFSIAES--IMGQVFKR 167
            :|::::..:.....||.:|                      ::|.|.:|::.|::  ||..|...
  Fly    92 LPKAVNTVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTA 156

  Fly   168 TGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYL-QSTGGIMRDQ-DYP---YVARKGKCQFV 227
            .....|||.||::||:..  ..||...:....|:|| |.|...:..: |||   .:...|.||..
  Fly   157 NPLPSSLSAQQLLDCAGM--GTGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPP 219

  Fly   228 PDLSV-VNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIY--DDPLCSSASVN 289
            ..:|| |.:..::.:...|:.|:...|::..||.:..|.:...|..||.|:|  :....::...:
  Fly   220 SSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSS 284

  Fly   290 HAMVVIGF------GKDYWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAY 335
            ..:||:|:      ..|||...|.:|..|||.|||||.:..|. .||..|.:
  Fly   285 QFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ-PIAKNAVF 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 14/60 (23%)
Peptidase_C1A 128..336 CDD:239068 65/247 (26%)
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 16/87 (18%)
Peptidase_C1A 114..336 CDD:239068 61/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12411
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.