DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5367 and Y71H2AM.3

Sequence 1:NP_609387.1 Gene:CG5367 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_497622.2 Gene:Y71H2AM.3 WormBaseID:WBGene00022168 Length:483 Species:Caenorhabditis elegans

Alignment Length:117 Identity:20/118 (17%)
Similarity:41/118 (35%) Gaps:27/118 (23%)


  Fly    24 EGNSSSANCKSEFEKFKNNNNRKYLRTYDEM-RSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNI 87
            :.|...|.||.:..|.:.|:...|  .:::: .:..|.::..:.:::.|.:    |.|..:...|
 Worm   297 KANIKCAGCKCQLGKIQKNHPDIY--CFNQIATTMTAGQKKIQFVDKLNMS----QLSIYMAQLI 355

  Fly    88 FADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFI 139
            .....|...:|..:|.|.                    .||..|.|....::
 Worm   356 LNGCETQSSMKLVIRTLD--------------------KVPYMLVWLLDSYV 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 9/61 (15%)
Peptidase_C1A 128..336 CDD:239068 3/13 (23%)
Y71H2AM.3NP_497622.2 HECT_2 <201..467 CDD:303071 20/118 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.