DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5367 and C32B5.13

Sequence 1:NP_609387.1 Gene:CG5367 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_493866.1 Gene:C32B5.13 WormBaseID:WBGene00016306 Length:150 Species:Caenorhabditis elegans

Alignment Length:149 Identity:42/150 (28%)
Similarity:72/150 (48%) Gaps:19/150 (13%)


  Fly   171 ILSLSKQQIVDCSVSHGN--QGCVGGSLRNTLSY-LQSTGGIMRDQDYPYVARKG-KCQFVPDLS 231
            :||.|:|||:||    ||  ..|    ..|.||: .....|::.:.|||||.::. ||::..:..
 Worm    10 VLSFSEQQIIDC----GNFTSPC----QENILSHEFIKKNGVVTEADYPYVGKENEKCKYDENKI 66

  Fly   232 VVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYD--DPLCSSASVNHAMVV 294
            .:..|:..::....|..::..:...||....:.|.|..|. |..|||.  ...|..|:...::.:
 Worm    67 KLWPTNMLLVGNLPETLLKLFIKEHGPGYFRMKAPPSFFN-YKTGIYSPTQEECGKATDARSLTI 130

  Fly   295 IGF----GKDYWILKNWWG 309
            :|:    |::|||:|..:|
 Worm   131 VGYGIEGGQNYWIVKGSFG 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 42/150 (28%)
C32B5.13NP_493866.1 Peptidase_C1 1..150 CDD:304901 42/150 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86152984
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.