DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5367 and LOC100492634

Sequence 1:NP_609387.1 Gene:CG5367 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_017952035.1 Gene:LOC100492634 ID: Length:269 Species:Xenopus tropicalis

Alignment Length:243 Identity:83/244 (34%)
Similarity:131/244 (54%) Gaps:18/244 (7%)


  Fly    44 NRKYLRTYDEMRSYKA-FEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTD-------GYLKGF 100
            ::|..:.::|.|:.:. :||..|.|..||..|..|..::.:..|...||:.:       ||    
 Frog    37 HQKSYKDWEEERARRTIWEETLKFITAHNLEYSLGLHTYEVGMNHLGDMTGEEVAATMTGY---- 97

  Fly   101 LRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIMGQVF 165
                 ::..||.||:..:....|.|..|.|:|||:||.:||..||..||||||||...::..|..
 Frog    98 -----TDSGDSLDNVVHVPKQILEALPPASIDWRTKGCVTPVRNQGECGSCYAFSAVGALECQWK 157

  Fly   166 KRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQFVPDL 230
            |:||.:::.|.|::||||.|.||.||.||||..:.:|::. .|:|.|..|.|..::..|:.....
 Frog   158 KKTGSLVTFSPQELVDCSESEGNNGCKGGSLNASFTYMKK-NGVMEDSAYKYTEKEEPCKKKKPS 221

  Fly   231 SVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIY 278
            :...|..:..||..:|.|::.||...|||::.|::|...|::|:.|.|
 Frog   222 NTGVVKDFYTLPAGNETALKKAVGIDGPVSVVIDSSCPGFRMYNSGEY 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 15/60 (25%)
Peptidase_C1A 128..336 CDD:239068 61/152 (40%)
LOC100492634XP_017952035.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.