DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5alpha and CDK5R2

DIOPT Version :8

Sequence 1:NP_001260320.1 Gene:Cdk5alpha / 34385 FlyBaseID:FBgn0027491 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_003927.1 Gene:CDK5R2 / 8941 HGNCID:1776 Length:367 Species:Homo sapiens

Alignment Length:338 Identity:128/339 (38%)
Similarity:173/339 (51%) Gaps:65/339 (19%)


  Fly   130 EKNLKKHSIFINALSWKKLSTSHNKKKIENKNKCANLPTACFKAQLLESSFASSSDKNRNIQLHC 194
            |..||:.|:.|:||:||:|..:..||| :...|....|             ||:.          
Human    51 ESRLKRPSVLISALTWKRLVAASAKKK-KGSKKVTPKP-------------ASTG---------- 91

  Fly   195 NRIDEHNQQHCNQHPHPHPHQHQLQLQNQHQHQNQNQNQNQNQVQDIREEVMTGPPGKS--QNPS 257
                            |.|...|...:|. ..:.::........:.:...|.|.|...:  :.||
Human    92 ----------------PDPLVQQRNRENL-LRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPS 139

  Fly   258 ----KAKDPVKVNNKNSMSNHNKLIQKQPLTLSLPQQVQASSIQTKNTNQIPRKTVIQASTSELL 318
                .|:.|.....|..                 |....|..:........||:.::||||.|||
Human   140 GGSAAAQPPGSGGGKPP-----------------PPPPPAPQVAPPVPGGSPRRVIVQASTGELL 187

  Fly   319 KCLGMFLHCRCQRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELVSGEE- 382
            :|||.|:..||.||.....|:.|.|.|.||||||||||||.|||.|||:||||:|.||.:.|:| 
Human   188 RCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDEL 252

  Fly   383 SKESDLQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLVIVNKLSDKMLKINAEPGF 447
            :..::|||:.||||||:||||||||||||||||||..||:||.|||.::.:||.:||::||:|.|
Human   253 ASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHF 317

  Fly   448 FTEVFTELKSCGQ 460
            ||:||.:||:.|:
Human   318 FTQVFQDLKNEGE 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk5alphaNP_001260320.1 CDK5_activator 107..458 CDD:281279 127/335 (38%)
CDK5R2NP_003927.1 CDK5_activator 40..326 CDD:281279 126/333 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9154343
eggNOG 1 0.900 E1_KOG3932
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3327
Isobase 1 0.950 0 Normalized mean entropy S4515
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492547at2759
OrthoFinder 1 1.000 FOG0001317
OrthoInspector 1 1.000 T609539
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23401
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.