DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5alpha and Cdk5r1

DIOPT Version :8

Sequence 1:NP_001260320.1 Gene:Cdk5alpha / 34385 FlyBaseID:FBgn0027491 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_034001.1 Gene:Cdk5r1 / 12569 MGIID:101764 Length:307 Species:Mus musculus

Alignment Length:339 Identity:135/340 (40%)
Similarity:184/340 (54%) Gaps:76/340 (22%)


  Fly   120 SVLKAEKSSFEKNLKKHSIFINALSWKKLSTSHNKKKIENKNKCANLPTACFKAQLLESSFASSS 184
            :.::..|::.:||||:||| |:.|.||::.....|||...|.:    |.:.:     :|:.|..:
Mouse    28 TAVQNSKNAKDKNLKRHSI-ISVLPWKRIVAVSAKKKNSKKAQ----PNSSY-----QSNIAHLN 82

  Fly   185 DKNRNIQLHCNRIDEHNQQHCNQHPHPHPHQHQLQLQNQHQHQNQNQNQNQNQVQDIREEVMTG- 248
            ::|....|.|..:....|....|.|.|...|                              ::| 
Mouse    83 NENLKKSLSCANLSTFAQPPPAQPPAPPASQ------------------------------LSGS 117

  Fly   249 PPGKSQNPSKAKDPVKVNNKNSMSNHNKLIQKQPLTLSLPQQVQASSIQTKNTNQIPRKTVIQAS 313
            ..|.|.:..||..|                                :|.:..|   |::.::|||
Mouse   118 QTGVSSSVKKAPHP--------------------------------AITSAGT---PKRVIVQAS 147

  Fly   314 TSELLKCLGMFLHCRCQRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELV 378
            |||||:|||.||..||.||.:....|.|:|||:||||||||||||..||.||||||:|||.|:::
Mouse   148 TSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVI 212

  Fly   379 SGEESKESDLQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLVIVNKLSDKMLKINA 443
            |.|...:.:|||.:|||||||||||||||||||||||||..||.||||||.::|.:|.|||:|||
Mouse   213 SSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINA 277

  Fly   444 EPGFFTEVFTELKS 457
            :|.:||:||::||:
Mouse   278 DPHYFTQVFSDLKN 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk5alphaNP_001260320.1 CDK5_activator 107..458 CDD:281279 135/340 (40%)
Cdk5r1NP_034001.1 CDK5_activator 20..293 CDD:308730 135/340 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9153905
eggNOG 1 0.900 E1_KOG3932
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3352
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492547at2759
OrthoFinder 1 1.000 FOG0001317
OrthoInspector 1 1.000 T616347
orthoMCL 1 0.900 OOG5_133447
Panther 1 1.100 O PTHR23401
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3652
TreeFam 1 0.960
1110.880

Return to query results.
Submit another query.