DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5alpha and cdk5r1

DIOPT Version :8

Sequence 1:NP_001260320.1 Gene:Cdk5alpha / 34385 FlyBaseID:FBgn0027491 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_002935561.1 Gene:cdk5r1 / 100497533 XenbaseID:XB-GENE-1032903 Length:292 Species:Xenopus tropicalis

Alignment Length:339 Identity:134/340 (39%)
Similarity:179/340 (53%) Gaps:95/340 (28%)


  Fly   125 EKSSFEKNLKKHSIFINALSWKKLSTSHNKKKIENKNKCANLPTACFKAQLLESSFASSSDKNRN 189
            :.|...|:||:||| |:.|.||:|....:||:...|.:                  |:.|.:|  
 Frog    31 QNSKNGKSLKRHSI-ISVLPWKRLVAVSSKKRQPKKGQ------------------ANGSYQN-- 74

  Fly   190 IQLHCNRIDEHNQQHCNQHPHPHPHQHQLQLQNQHQHQNQNQNQNQNQVQDIREEVMTGPPGKSQ 254
                       |..|.|                                              |:
 Frog    75 -----------NITHLN----------------------------------------------SE 82

  Fly   255 NPSKAKDPVKVNNKNSMSNHNK-LIQK---QPLTLSLPQQVQASSIQTKNTNQIPRKTVIQASTS 315
            |..|:   :...|.:|.:...| .:.|   ..:|.:..||:.||          |::.|:|||||
 Frog    83 NLKKS---ISCANLSSFTQDTKDSLSKGVGASITKAAGQQIHAS----------PKRVVVQASTS 134

  Fly   316 ELLKCLGMFLHCRCQRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELVSG 380
            |||:|||.||..||.:|.:....:.|:|||:||||||||||||..||.|||:||:|||.|:.:|.
 Frog   135 ELLRCLGEFLCRRCYKLKHLSPTEPVLWLRSVDRSLLLQGWQDQGFITPANIVFLYMLCRDTISS 199

  Fly   381 EESKESDLQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLVIVNKLSDKMLKINAEP 445
            |.:.|.||||::|||:|||||||||||||||||||||:|||.||||||.|:..:|.|||:|||:|
 Frog   200 ELNTEQDLQAALLTCVYLSYSYMGNEISYPLKPFLVENSKEDFWDRCLSIITMMSAKMLRINADP 264

  Fly   446 GFFTEVFTELKSCG 459
            .:||::|.:|||.|
 Frog   265 QYFTQIFADLKSEG 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk5alphaNP_001260320.1 CDK5_activator 107..458 CDD:281279 133/337 (39%)
cdk5r1XP_002935561.1 CDK5_activator 37..276 CDD:281279 131/330 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9155444
eggNOG 1 0.900 E1_KOG3932
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I2906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492547at2759
OrthoFinder 1 1.000 FOG0001317
OrthoInspector 1 1.000 T601399
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3652
TreeFam 1 0.960
98.880

Return to query results.
Submit another query.