DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hand and nhlh2

Sequence 1:NP_609370.2 Gene:Hand FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_991232.1 Gene:nhlh2 ZFINID:ZDB-GENE-040426-1809 Length:122 Species:Danio rerio

Alignment Length:76 Identity:35/77 (45%)
Similarity:48/77 (62%) Gaps:9/77 (12%)


  Fly    49 VPTSNTRIVKKRN---TAN------KKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAI 104
            ||.:.||..|:|.   ||.      .:||.|.::.|.||:.||:.:|.:|.|.|||||:.|:|||
Zfish    46 VPAALTREEKRRRRRATAKYRSAHATRERIRVEAFNVAFAELRKLLPTLPPDKKLSKIEILRLAI 110

  Fly   105 LYINYLVNVLD 115
            .||:||.:|||
Zfish   111 CYISYLNHVLD 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 26/60 (43%)
nhlh2NP_991232.1 HLH 66..116 CDD:278439 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.