DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Utx and tmtc2b

Sequence 1:NP_609368.3 Gene:Utx FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_021323440.1 Gene:tmtc2b ZFINID:ZDB-GENE-081031-100 Length:837 Species:Danio rerio

Alignment Length:377 Identity:72/378 (19%)
Similarity:133/378 (35%) Gaps:121/378 (32%)


  Fly   146 NNYWTNHAFIYGIGVAYFKLRCFKW---------------AIKSFQELLYLSPNFTCANEVHLRL 195
            |..|.|...:|..|::....:.  |               |.::::..||...|..   ::...|
Zfish   475 NRDWQNEEMLYKSGISVNPAKA--WGNLGNVLKNQGKVEEAEQAYRNALYYRRNMA---DMLYNL 534

  Fly   196 GLMLKHCGEFHIALKHLQLA------LLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLL 254
            ||:|:....|..||.:.:||      |...|.:|...|.          .|.:.:.||..:   :
Zfish   535 GLLLQENSRFSEALHYYKLAIGSRPTLASAYLNTGIVLM----------NQGRLEEAKRTF---V 586

  Fly   255 NEKNISLELKADVYRQLGWMYHCVECLGE---KKEREANALNFLQKSIEADPK--SGQSLY-LLG 313
            ....||.|...|.:.....:..|:..||:   ::..:..|::..:::|:..|:  :.|||| ::|
Zfish   587 TCAEISDENLKDPHAHKSSVTSCLYNLGKLLHEQGHQEEAISVYKEAIQKMPRQFAPQSLYNMMG 651

  Fly   314 RCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLD-------- 370
            ..:..:||:.:|...|:.|:.....:.....:.|.|.....|.|:|.:.::.|::||        
Zfish   652 EAFMRLNKLTEAEHWYKESLRAKPDHIPAHLTYGKLLAMTGQKTEAEKFFLKAIELDPTKGNCYM 716

  Fly   371 ------------------------------------------------------------KDHKA 375
                                                                        .::.|
Zfish   717 HYGQFLLEESRLLEAAEMAEKAAQLDTEEFDVVFSAAHMLRQASLNDAAEKYYRQAASLRPNYPA 781

  Fly   376 AWTNLGILYESCGQLRDAYACYLNATK--------QISFQKSSLIRKKQAIR 419
            |..|||.:....|:|::|.|.||.|.:        |.:.:|...|.:||.:|
Zfish   782 ALMNLGAILHLNGKLQEAEANYLRALQLKPDDTITQSNLRKLWNIMEKQGLR 833

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 8/49 (16%)
TPR_11 156..216 CDD:290150 16/81 (20%)
TPR repeat 186..216 CDD:276809 9/36 (25%)
TPR repeat 228..255 CDD:276809 3/27 (11%)
TPR_11 264..337 CDD:290150 17/79 (22%)
TPR repeat 265..300 CDD:276809 6/38 (16%)
TPR repeat 307..334 CDD:276809 10/28 (36%)
TPR_11 339..402 CDD:290150 20/131 (15%)
TPR repeat 339..369 CDD:276809 6/30 (20%)
TPR_1 340..373 CDD:278916 8/101 (8%)
TPR repeat 374..402 CDD:276809 12/28 (43%)
JmjC 870..978 CDD:202224
tmtc2bXP_021323440.1 DUF1736 250..323 CDD:312047
TPR 482..713 CDD:223533 51/249 (20%)
TPR repeat 494..522 CDD:276809 3/30 (10%)
TPR repeat 527..557 CDD:276809 9/33 (27%)
TPR repeat 562..585 CDD:276809 6/33 (18%)
TPR repeat 609..635 CDD:276809 5/26 (19%)
TPR repeat 640..673 CDD:276809 10/33 (30%)
TPR_11 <644..824 CDD:330823 32/180 (18%)
TPR repeat 678..706 CDD:276809 6/28 (21%)
TPR repeat 780..808 CDD:276809 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.