DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Utx and Ogt

Sequence 1:NP_609368.3 Gene:Utx FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_631883.2 Gene:Ogt MGIID:1339639 Length:1046 Species:Mus musculus

Alignment Length:545 Identity:117/546 (21%)
Similarity:197/546 (36%) Gaps:123/546 (23%)


  Fly    13 RELDSRYYGFLDLSNSKNAELRNLVQQTITNLQN-YIANGQVHESKNSSDNKNAIQKFEPSTQAG 76
            |.|| |...|..|:..:|.    |:.:..:||.| |...||:.|                   |.
Mouse    69 RRLD-RSAHFSTLAIKQNP----LLAEAYSNLGNVYKERGQLQE-------------------AI 109

  Fly    77 EHMENTSSRNNDDTKPFEQDAKEKVSIIEEKHQDEHYVNAL-------C---KLGHLHLLLGEYS 131
            ||..:......|....:...|...|:..:.:...:.||:||       |   .||:|...||...
Mouse   110 EHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLE 174

  Fly   132 EALSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRC-FK-----W-AIKSFQELLYLSPNFTCAN 189
            ||.:.|.|.:..:.|           ..||:..|.| |.     | ||..|::.:.|.|||.   
Mouse   175 EAKACYLKAIETQPN-----------FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFL--- 225

  Fly   190 EVHLRLGLMLKHCGEF---------------HIALKHLQLALLY-----------TYPSTFSELQ 228
            :.::.||.:||....|               :.|:.|..||.:|           ||.... |||
Mouse   226 DAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI-ELQ 289

  Fly   229 VKF-----QIAHLYEVQNKHKAAKDGYEFLLNEKNISLEL---KADVYRQLGWMYHCVECLGEKK 285
            ..|     .:|:..:.:.....|:|.|       |.:|.|   .||          .:..|...|
Mouse   290 PHFPDAYCNLANALKEKGSVAEAEDCY-------NTALRLCPTHAD----------SLNNLANIK 337

  Fly   286 EREAN---ALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIG 347
            ..:.|   |:...:|::|..|:...:...|........|:.:|.:.|:.::..|...||.:.::|
Mouse   338 REQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG 402

  Fly   348 VLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLI 412
            ...::......|||.|..|:|::.....|.:||..:::..|.:.:|.|.|..|.|.......:..
Mouse   403 NTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYC 467

  Fly   413 RKKQAIRMKKDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQ 477
            .....:::..|.....:.:.:.::.:..||.:..|||:......|..:...:...|:....:...
Mouse   468 NLAHCLQIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCL 532

  Fly   478 QTAQMLPRQVTKQSPVQGPPPPYPH 502
            ....:|.:            |||.|
Mouse   533 DKINVLHK------------PPYEH 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 9/41 (22%)
TPR_11 156..216 CDD:290150 22/82 (27%)
TPR repeat 186..216 CDD:276809 9/45 (20%)
TPR repeat 228..255 CDD:276809 6/32 (19%)
TPR_11 264..337 CDD:290150 14/76 (18%)
TPR repeat 265..300 CDD:276809 7/38 (18%)
TPR repeat 307..334 CDD:276809 4/27 (15%)
TPR_11 339..402 CDD:290150 17/63 (27%)
TPR repeat 339..369 CDD:276809 9/30 (30%)
TPR_1 340..373 CDD:278916 9/33 (27%)
TPR repeat 374..402 CDD:276809 8/28 (29%)
JmjC 870..978 CDD:202224
OgtNP_631883.2 TPR 1 21..54
TPR_11 <22..>465 CDD:330823 104/452 (23%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809 6/15 (40%)
TPR 2 89..122 11/52 (21%)
TPR repeat 89..117 CDD:276809 10/47 (21%)
TPR repeat 122..152 CDD:276809 6/30 (20%)
TPR 3 123..156 6/33 (18%)
TPR 4 157..190 11/44 (25%)
TPR repeat 157..185 CDD:276809 10/28 (36%)
TPR 5 191..224 12/33 (36%)
TPR repeat 191..219 CDD:276809 9/28 (32%)
TPR 6 225..258 5/36 (14%)
TPR repeat 226..253 CDD:276809 5/27 (19%)
TPR 7 259..292 10/34 (29%)
TPR repeat 259..287 CDD:276809 7/29 (24%)
TPR 8 293..326 7/40 (18%)
TPR repeat 293..321 CDD:276809 6/35 (17%)
TPR 9 327..360 9/43 (21%)
TPR repeat 327..355 CDD:276809 7/38 (18%)
TPR repeat 360..390 CDD:276809 4/30 (13%)
TPR 10 361..394 5/33 (15%)
TPR 11 395..428 9/33 (27%)
TPR repeat 395..423 CDD:276809 8/28 (29%)
TPR 12 429..462 9/33 (27%)
TPR repeat 429..457 CDD:276809 8/28 (29%)
TPR 13, truncated 463..473 0/10 (0%)
Nuclear localization signal. {ECO:0000255} 487..503 3/16 (19%)
Glyco_transf_41 556..1023 CDD:316369
Required for phosphatidylinositol 3,4,5-triphosphate binding 991..1010
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.