DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trk and Nog

DIOPT Version :8

Sequence 1:NP_476767.2 Gene:trk / 34376 FlyBaseID:FBgn0003751 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_037122.1 Gene:Nog / 25495 RGDID:3183 Length:232 Species:Rattus norvegicus

Alignment Length:173 Identity:44/174 (25%)
Similarity:65/174 (37%) Gaps:49/174 (28%)


  Fly    38 ELSTQSLAKILGQAFNPRYMSIDPP-------GEPEEKSYHLG------YKRSSYELPFYADSDA 89
            :|:...|..:||..::|.:|:..||       |.|...:..|.      .:|.|..:|       
  Rat    60 DLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMP------- 117

  Fly    90 ISVSHFPAWETNHFALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPW-----ECSSKINW 149
               |.....|.:. .|.:.||:. .||.||.                |.:.|     .|.....|
  Rat   118 ---SEIKGLEFSE-GLAQGKKQR-LSKKLRR----------------KLQMWLWSQTFCPVLYAW 161

  Fly   150 IDLGLNYFPRYIRSIECIA-RKCWY-DHFNCKP-KSFTIKVLR 189
            .|||..::|||::...|.: |.|.. :...||| ||..:.|||
  Rat   162 NDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLR 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
trkNP_476767.2 None
NogNP_037122.1 Noggin 12..232 CDD:310417 44/174 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1391421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.