DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4953 and Trappc13

DIOPT Version :8

Sequence 1:NP_609365.3 Gene:CG4953 / 34373 FlyBaseID:FBgn0032204 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_080155.3 Gene:Trappc13 / 66975 MGIID:1914225 Length:418 Species:Mus musculus

Alignment Length:417 Identity:189/418 (45%)
Similarity:257/418 (61%) Gaps:17/418 (4%)


  Fly     1 MEMVEP-DAHLVALKVMRLMRPTLVGLGPVVTCEPTDLV-QRFSSSQESDGMSGACAETLAAGQV 63
            ||:..| ..||:|||||||.:|||....| ||||..||. ..|:...:.|..:...||.|..|::
Mouse     1 MEVNPPKQEHLLALKVMRLTKPTLFTNIP-VTCEEKDLPGDLFNQLMKDDPSTVNGAEILMLGEM 64

  Fly    64 LLLPQSFGSIYLGETFASYICVHNTTPNPVECVTVKADLQSNTSRINLSMHENAKSPVVLPPGGT 128
            |.|||:||:|:|||||:|||.|||.:...|:.:.||||||:::.|:|||....|.:.  |.|...
Mouse    65 LTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAE--LKPDCC 127

  Fly   129 IDDVIRYEVKEIGTHILVCEVNYSTPAGYAQSLRKFFKFQVLKPLDVKTKFYNAE------IDEI 187
            |||||.:||||||||||||.|:|:|..|.....||||||||||||||||||||||      .||:
Mouse   128 IDDVIHHEVKEIGTHILVCAVSYTTQGGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEV 192

  Fly   188 YLEAQIQNVTTSPFCLEKVELDGSEDYSVTPLNTLPN-GE--SVFTVKHMLQPNNSCQFLYCIKP 249
            :|||||||:||||..:|||.|:.|..|:||.||::.. ||  |.|..:..|||.::.|:|||:||
Mouse   193 FLEAQIQNITTSPMFMEKVSLEPSIMYNVTELNSVTQAGECISTFGSRGYLQPMDTRQYLYCLKP 257

  Fly   250 KGDIAKNVDTLRQFNNVGKLDIVWRSNLGEKGRLQTSQLQRLPFECKTLRLEVLDAKNTIKIGTI 314
            |.:.|:....::....:|||||||::||||:||||||||||:......:||.:....:|:.:...
Mouse   258 KKEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEP 322

  Fly   315 FTFNCRVTN-TSEHPMKLNVRLAAKFSPDSQYTGCADFMLNLLQSGESAEFPLSVCPSKLGLVKI 378
            |...|::|| :||..|.|.:.:....|  ..:.|.:...|..|....|....|::..|..||..:
Mouse   323 FHITCKITNCSSERMMDLVLEMCNTNS--IHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSV 385

  Fly   379 TPLVLTNTLQNEQFTIENVVDVFVVNS 405
            :.|.||:|.....:..:::..|.||::
Mouse   386 SGLRLTDTFLKRTYEYDDIAQVCVVSA 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4953NP_609365.3 DUF974 64..289 CDD:283752 132/234 (56%)
Trappc13NP_080155.3 DUF974 65..297 CDD:283752 132/234 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222099620
eggNOG 1 0.900 E1_KOG2625
Hieranoid 1 1.000
Homologene 1 1.000 H11792
Inparanoid 1 1.050 309 1.000 Inparanoid score I2572
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006242
OrthoInspector 1 1.000 T1083529
orthoMCL 1 0.900 OOG5_130075
Panther 1 1.100 LDO PTHR13134
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2871
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.