DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4953 and C56C10.7

DIOPT Version :8

Sequence 1:NP_609365.3 Gene:CG4953 / 34373 FlyBaseID:FBgn0032204 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_741009.1 Gene:C56C10.7 / 174089 WormBaseID:WBGene00016964 Length:401 Species:Caenorhabditis elegans

Alignment Length:415 Identity:152/416 (37%)
Similarity:224/416 (54%) Gaps:49/416 (12%)


  Fly    10 LVALKVMRLMRPTLVGLGPV--VTCEPTD-------LVQRFSS-SQESDGMSGACAETLAAGQVL 64
            |:||:||||.||.   ..||  .:.:|.|       |..:.|. |:||       .:.|..|:.|
 Worm    13 LLALRVMRLARPK---FAPVDGFSHDPVDPTGFGELLAGKVSEISKES-------RQDLPIGEYL 67

  Fly    65 LLPQSFGSIYLGETFASYICVHNTTPNPVECVTVKADLQSNTSRINLSMHENAKSPVVLP---PG 126
            :.||.|.:|||||||..|:.|.|.:...|..|::|.:||::|.|            ||||   ..
 Worm    68 IAPQMFENIYLGETFTFYVNVVNESEKTVSSVSLKCELQTSTQR------------VVLPCSVQD 120

  Fly   127 GTID------DVIRYEVKEIGTHILVCEVNYSTPAGYAQSLRKFFKFQVLKPLDVKTKFYNAEID 185
            .||:      .||.:||||||.|||:|.|||.|..|.....||||||.|.||:|||||||:||.:
 Worm   121 ATIESSKCEGQVISHEVKEIGQHILICSVNYKTSNGENMYFRKFFKFPVSKPIDVKTKFYSAEDN 185

  Fly   186 ---EIYLEAQIQNVTTSPFCLEKVELDGSEDYSVTPLNTLPNGESVFTVKHMLQPNNSCQFLYCI 247
               ::||||||:|.:.:...|||||||.|:.|:||   ::.:.:....|..:|:|.:..|||:|:
 Worm   186 ANQDVYLEAQIENTSNANMFLEKVELDPSQHYNVT---SIAHEDEFGDVGKLLKPKDIRQFLFCL 247

  Fly   248 KPKGDIAKNVDTLRQFNNVGKLDIVWRSNLGEKGRLQTSQLQRLPFECKTLRLEVLDAKNTIKIG 312
            .| .|: .|....:...::||||:.||:::|||||||||.|||:......:||.|......:.:.
 Worm   248 TP-ADV-HNTLGYKDLTSIGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQ 310

  Fly   313 TIFTFNCRVTNTSEHPMKLNVRLAAKFSPDSQYTGCADFMLNLLQSGESAEFPLSVCPSKLGLVK 377
            ..|..:||:.|.||..:.|.:||....:....:...:...|..|...:..:|.|:|.|..:|:..
 Worm   311 KPFEVSCRLYNCSERALDLQLRLEQPSNRHLVFCSPSGVSLGQLPPSQHVDFSLNVFPVTVGIQS 375

  Fly   378 ITPLVLTNTLQNEQFTIENVVDVFV 402
            |:.:.:|:|.....:..:::..:||
 Worm   376 ISGIRITDTFTKRIYEHDDIAQIFV 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4953NP_609365.3 DUF974 64..289 CDD:283752 106/237 (45%)
C56C10.7NP_741009.1 DUF974 67..287 CDD:283752 106/237 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222090597
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H11792
Inparanoid 1 1.050 225 1.000 Inparanoid score I2211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1608721at2759
OrthoFinder 1 1.000 FOG0006242
OrthoInspector 1 1.000 T474008
orthoMCL 1 0.900 OOG5_130075
Panther 1 1.100 LDO PTHR13134
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2871
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.