DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4908 and AT4G30250

Sequence 1:NP_609358.1 Gene:CG4908 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001328009.1 Gene:AT4G30250 AraportID:AT4G30250 Length:521 Species:Arabidopsis thaliana

Alignment Length:407 Identity:107/408 (26%)
Similarity:182/408 (45%) Gaps:67/408 (16%)


  Fly    79 SVETN-FVQNDNGTIKTSYDFIPSIGKHLFQYKGNWIQVERTREQQTLDLHMGVP--WETVT--- 137
            ||..| .|.:.|...:.|...:|:.....|....|         .:..|:..||.  ||.|.   
plant    77 SVTVNDAVSSSNNNTRLSLTRVPNSSSVTFGLSNN---------DRITDVFNGVTILWEHVVVQR 132

  Fly   138 -LTAFG------NNKGIYFDILEEARQLALEA----TEGKT----------VLYT-----AMGAE 176
             :.:|.      ..:|....|.:..:.|.|::    ..||:          :|||     ::.|.
plant   133 QVQSFSWRPMPEEKRGFTLQINKRDKALVLDSYLDYIVGKSEEIRRRNEERLLYTNSRGVSLDAR 197

  Fly   177 WRPFGHPRRRRPT--GSVVLDRGTSQRIIADCQDFIKSSLWYTQRGIPYRRGYLLYGPPGCGKSS 239
            ..|:...|.:.|:  .::.:|....:||:.|.::|.....:|.:.|..::||||||||||.||||
plant   198 SHPWDSVRFKHPSTFDTLAMDPEKKKRIMEDLREFANGQGFYQKTGRAWKRGYLLYGPPGTGKSS 262

  Fly   240 FITALAGELEYSVCLLNLSERGLTDDRLNHLLNVAPEQSIILLEDIDA--AFVSREATPQQKSAF 302
            .|.|:|..|.|.:..|.|:| ...:..|..||.....:|||::||||.  :...|....::..::
plant   263 LIAAMANYLGYDIYDLELTE-VQNNSELRKLLMKTSSKSIIVIEDIDCSISLTKRGKNKKKNGSY 326

  Fly   303 D---------GL----NRITFSGLLNCLDGVGST--EARIVFMTTNYIDRLDPALVRPGRIDLKE 352
            :         ||    :.:|.|||||..||:.|.  ..:|...|||:|::||.||:|.||:|:..
plant   327 EYDPGLTNGSGLEEPGSSVTLSGLLNFTDGLWSCCGSEKIFVFTTNHIEKLDSALMRSGRMDMHV 391

  Fly   353 YIGYCTQYQLEEMFKNFF----ASSDTTKAEEFGKRVNSFGRSASPAQIQGFFMKHKLSSPQTVI 413
            ::|:|....|:.:.||:.    ...|:...:|..:.|..  ...:||.:....::::..:.:.|.
plant   392 HMGFCKFPALKILLKNYLRLEEEDMDSVVLKEMEECVEE--AEITPADVSEVLIRNRSDAEKAVR 454

  Fly   414 DSCEDIWENVLDHNKKI 430
            :....:.|.|:...|.:
plant   455 EIVSVLKERVVKRRKSV 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 29/147 (20%)
AAA 224..358 CDD:214640 59/151 (39%)
AAA 227..356 CDD:278434 56/146 (38%)
AT4G30250NP_001328009.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1848
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D532729at2759
OrthoInspector 1 1.000 T124360
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23070
Phylome 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.