DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5731 and AGAL2

Sequence 1:NP_609354.1 Gene:CG5731 FlyBaseID:FBgn0032192 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_568193.1 Gene:AGAL2 AraportID:AT5G08370 Length:396 Species:Arabidopsis thaliana

Alignment Length:406 Identity:156/407 (38%)
Similarity:221/407 (54%) Gaps:38/407 (9%)


  Fly     4 TLWIILLSSTFG----KCLDNGLAKTPPMGWLSWERFRCNTDCVNDPDNCISEQLFQTMTDIVVA 64
            ||.|.|.....|    ..::||||.:|.|||.||..|:||          |:|.|.:...|.:|:
plant    14 TLTITLTQIADGFQSRMLMNNGLALSPQMGWNSWNHFQCN----------INETLIKQTADAMVS 68

  Fly    65 DGYASVGYEYINIDDCWLEKHRSHDGKLVADRKRFPNGIKALSDYIHSRGLKFGIYEDYGNYTCA 129
            .|.:::||:||||||||.|..|...|.|||....||:||||||||:||:|||.|||.|.|..||:
plant    69 SGLSAIGYKYINIDDCWGELKRDSQGSLVAKASTFPSGIKALSDYVHSKGLKLGIYSDAGTLTCS 133

  Fly   130 -GYPGIIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHGYSTFGRLLNSTGKSMVYS-CSWPVY 192
             ..||.:|:||:||..||.|.:||:|.|.|..........|....:.|.::|:|:.:| |.|   
plant   134 QTMPGSLGHEEQDAKTFASWGIDYLKYDNCENTGTSPRERYPKMSKALLNSGRSIFFSLCEW--- 195

  Fly   193 QIYAGIQPNYSAIQTHCNLWRNYDDIQDSWASVENIIDYYGNNQDVIAPNAGPGHWNDPDMLIIG 257
                |.:...:......|.||...||||:|.|:..|.|    ..|..|..|.||.|||||||.:|
plant   196 ----GQEDPATWAGDIGNSWRTTGDIQDNWKSMTLIAD----QNDRWASYARPGSWNDPDMLEVG 252

  Fly   258 NFGLSYEQAKTQFAIWSILAAPLLMSVDLRTIRPQFKHILQNRKIIAVDQDPLGIQGRRIYKHKG 322
            |.|::.|:..:.|:||::..||||:..|||::......:|.|:::|||:||.|||||:::.|...
plant   253 NGGMTKEEYMSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVKKEGD 317

  Fly   323 IEIWSRPIGPLYQNFYSYAIAFVNRRTDGTPS-DISVTLKELGLINFSGYRVEDLYENVDYGVLY 386
            :|:|:   |||.:.  ..|:...||   |:.| :|:....|:||.:.......||:|:..|..: 
plant   318 LEVWA---GPLSKK--RVAVILWNR---GSASANITARWAEIGLNSSDIVNARDLWEHSTYSCV- 373

  Fly   387 PNTKIKVKVNPSGVVM 402
             ..::...|.|....|
plant   374 -KKQLSALVEPHACKM 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5731NP_609354.1 AmyAc_family 25..399 CDD:298606 146/377 (39%)
AGAL2NP_568193.1 PLN02808 9..394 CDD:166449 156/407 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I903
OMA 1 1.010
OrthoDB 1 1.010 D964130at2759
OrthoInspector 1 1.000 T32181
orthoMCL 1 0.900 OOG5_127620
Panther 1 1.100 O PTHR11452
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.