DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5731 and naga

Sequence 1:NP_609354.1 Gene:CG5731 FlyBaseID:FBgn0032192 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001032465.2 Gene:naga ZFINID:ZDB-GENE-051113-256 Length:437 Species:Danio rerio

Alignment Length:406 Identity:205/407 (50%)
Similarity:265/407 (65%) Gaps:17/407 (4%)


  Fly     5 LW----IILLSSTFGKCLDNGLAKTPPMGWLSWERFRCNTDCVNDPDNCISEQLFQTMTDIVVAD 65
            :|    :.|..|:....|||||.:|||||||:||||||:.||.|||.||||||||..|.|.:..|
Zfish     1 MWSACVLFLAFSSAALALDNGLMRTPPMGWLAWERFRCDIDCQNDPYNCISEQLFMDMADRLSED 65

  Fly    66 GYASVGYEYINIDDCWLEKHRSHDGKLVADRKRFPNGIKALSDYIHSRGLKFGIYEDYGNYTCAG 130
            |:..:||.|:||||||..|.|...|:|..|.||||.||..|:.|:|.||||.|||.|.|..||.|
Zfish    66 GWKELGYVYVNIDDCWSSKDRDAQGRLQPDPKRFPRGIPHLAQYVHDRGLKLGIYGDMGTLTCGG 130

  Fly   131 YPG-IIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHGYSTFGRLLNSTGKSMVYSCSWPVYQI 194
            ||| .:...|.||..||||.:|.:||||||:.....:.||....:.||:||:.:.||||||.|| 
Zfish   131 YPGTTLDKIETDAQTFADWGIDMLKLDGCYSNSSYQEQGYPMMSKALNATGRPIGYSCSWPAYQ- 194

  Fly   195 YAGIQP--NYSAIQTHCNLWRNYDDIQDSWASVENIIDYYGNNQDVIAPNAGPGHWNDPDMLIIG 257
             .|:.|  ||:.:...||||||||||||||.||..|:|::.:|||.:.|.|.||.||||||||||
Zfish   195 -GGLPPKVNYTLLGQICNLWRNYDDIQDSWDSVMGIVDWFFDNQDALQPAAAPGQWNDPDMLIIG 258

  Fly   258 NFGLSYEQAKTQFAIWSILAAPLLMSVDLRTIRPQFKHILQNRKIIAVDQDPLGIQGRRIYKHK- 321
            :|.||.:|::.|.|:|||:||||.||.|||||....:.:|||:.:|:::||||||||||:.|.| 
Zfish   259 DFSLSLDQSRAQMALWSIMAAPLFMSNDLRTISSAARSVLQNKAVISINQDPLGIQGRRLLKEKS 323

  Fly   322 GIEIWSRPIGPLYQNFYSYAIAFVNRRTDGTPSDISVTLKELGLINFSGYRVEDLYENVDYGVLY 386
            ||:::.||:..     .:.|:.|.:||:| .|...:.:||.|| .....:.|.|::.......|.
Zfish   324 GIQVFQRPLSK-----GASALVFFSRRSD-MPYRYTTSLKTLG-YQPGVFEVFDVFSEQRLPELK 381

  Fly   387 PNTKIKVKVNPSGVVM 402
            .:|:..|.:|||||||
Zfish   382 DSTQFTVSINPSGVVM 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5731NP_609354.1 AmyAc_family 25..399 CDD:298606 193/378 (51%)
nagaNP_001032465.2 AmyAc_family 25..394 CDD:324178 193/378 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358264211
eggNOG 1 0.900 E1_KOG2366
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H221
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D266390at33208
OrthoFinder 1 1.000 FOG0001776
OrthoInspector 1 1.000 T596776
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11452
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.