DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5731 and NAGA

Sequence 1:NP_609354.1 Gene:CG5731 FlyBaseID:FBgn0032192 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_000253.1 Gene:NAGA HGNCID:7631 Length:411 Species:Homo sapiens

Alignment Length:401 Identity:211/402 (52%)
Similarity:268/402 (67%) Gaps:22/402 (5%)


  Fly    18 LDNGLAKTPPMGWLSWERFRCNTDCVNDPDNCISEQLFQTMTDIVVADGYASVGYEYINIDDCWL 82
            |||||.:|||||||:|||||||.:|..||.||||||||..|.|.:..||:..:||.|:||||||:
Human    18 LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWI 82

  Fly    83 EKHRSHDGKLVADRKRFPNGIKALSDYIHSRGLKFGIYEDYGNYTCAGYPG-IIGYEEKDALQFA 146
             ..|...|:|:.|.||||:||..|:||:||.|||.|||.|.||:||.|||| .:....:||..||
Human    83 -GGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFA 146

  Fly   147 DWNVDYVKLDGCYALPYDMDHGYSTFGRLLNSTGKSMVYSCSWPVYQIYAGIQP--NYSAIQTHC 209
            :|.||.:|||||::.|.:...||......||:||:.:.:|||||.|:  .|:.|  |||.:...|
Human   147 EWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYE--GGLPPRVNYSLLADIC 209

  Fly   210 NLWRNYDDIQDSWASVENIIDYYGNNQDVIAPNAGPGHWNDPDMLIIGNFGLSYEQAKTQFAIWS 274
            |||||||||||||.||.:|::::..:||::.|.||||||||||||:|||||||.||::.|.|:|:
Human   210 NLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWT 274

  Fly   275 ILAAPLLMSVDLRTIRPQFKHILQNRKIIAVDQDPLGIQGRRIYKHKG-IEIWSRPIGPLYQNFY 338
            :||||||||.|||||..|...||||..:|.::|||||||||||:|.|. ||::.||:    .|..
Human   275 VLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPL----SNKA 335

  Fly   339 SYAIAFVNRRTDGTPSDISVTLKELGLINFSG---YRVEDLYENVDYGVLYPNTKIKVKVNPSGV 400
            | |:.|.:.||| .|....   ..||.:||:|   |..:|:|.......|...|...|.:|||||
Human   336 S-ALVFFSCRTD-MPYRYH---SSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGV 395

  Fly   401 VMLKGEVQYPV 411
            ||.   ..||:
Human   396 VMW---YLYPI 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5731NP_609354.1 AmyAc_family 25..399 CDD:298606 200/381 (52%)
NAGANP_000253.1 AmyAc_family 25..394 CDD:324178 200/381 (52%)
Substrate binding 78..79 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358255147
eggNOG 1 0.900 E1_KOG2366
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H221
Inparanoid 1 1.050 410 1.000 Inparanoid score I1849
Isobase 1 0.950 0.930827 Normalized mean entropy S1639
OMA 1 1.010
OrthoDB 1 1.010 D266390at33208
OrthoFinder 1 1.000 FOG0001776
OrthoInspector 1 1.000 T609878
orthoMCL 1 0.900 OOG5_127620
Panther 1 1.100 LDO PTHR11452
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R31
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.