DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5731 and CG7997

Sequence 1:NP_609354.1 Gene:CG5731 FlyBaseID:FBgn0032192 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_611119.1 Gene:CG7997 FlyBaseID:FBgn0034117 Length:417 Species:Drosophila melanogaster

Alignment Length:403 Identity:244/404 (60%)
Similarity:303/404 (75%) Gaps:5/404 (1%)


  Fly     5 LWIILLSSTFGKCLDNGLAKTPPMGWLSWERFRCNTDCVNDPDNCISEQLFQTMTDIVVADGYAS 69
            |.:.:|..:.|  ||||||..|||||:|||||||.|||...||.||||:|||...|::|::|||.
  Fly    13 LLLQVLQLSMG--LDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKLFQRHADLLVSEGYAD 75

  Fly    70 VGYEYINIDDCWLEKHRSHD-GKLVADRKRFPNGIKALSDYIHSRGLKFGIYEDYGNYTCAGYPG 133
            .||||:.||||||||:|.:| .|||.||||||||:.||||:||::|||||:|:|||..|||||||
  Fly    76 AGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQGLKFGLYQDYGTNTCAGYPG 140

  Fly   134 IIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHGYSTFGRLLNSTGKSMVYSCSWPVYQIYAGI 198
            :|.:.:.||..||||:|||||||||||...||..||..||||||.||:.||||||||.||..||.
  Fly   141 VIKHMKLDAQTFADWDVDYVKLDGCYANISDMASGYPEFGRLLNETGRPMVYSCSWPAYQEDAGE 205

  Fly   199 QPNYSAIQTHCNLWRNYDDIQDSWASVENIIDYYGNNQDVIAPNAGPGHWNDPDMLIIGNFGLSY 263
            .|:|.:::.|||||||:|||:||..|:..||||:..|||.|.|:.|||||||||||::||:||||
  Fly   206 MPDYESLKQHCNLWRNWDDIEDSLESLMQIIDYFAKNQDRIQPHGGPGHWNDPDMLLLGNYGLSY 270

  Fly   264 EQAKTQFAIWSILAAPLLMSVDLRTIRPQFKHILQNRKIIAVDQDPLGIQGRRIYKHKGIEIWSR 328
            :|:|.|.|||:|:||||:||.||..:||:.|.|||||.:||||||.|||||||:.....||:|.|
  Fly   271 DQSKLQMAIWAIMAAPLIMSNDLAAVRPEIKAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKR 335

  Fly   329 PIGPLYQN-FYSYAIAFVNRRTDGTPSDISVTLKELGLINFSGYRVEDLYE-NVDYGVLYPNTKI 391
            ||.|:.:: .:|||:|||:||.||.|..|..|:|||||.|..||.|:|||: :...||....::.
  Fly   336 PITPVTKSGHHSYAVAFVSRRDDGAPYRIPFTVKELGLTNPKGYNVQDLYDASSKLGVFQSESQF 400

  Fly   392 KVKVNPSGVVMLK 404
            ..:|||:||...|
  Fly   401 ITRVNPNGVTFYK 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5731NP_609354.1 AmyAc_family 25..399 CDD:298606 232/377 (62%)
CG7997NP_611119.1 AmyAc_family 31..408 CDD:298606 232/377 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C357221164
eggNOG 1 0.900 E1_KOG2366
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I903
Isobase 1 0.950 0.930827 Normalized mean entropy S1639
OrthoDB 1 1.010 D266390at33208
OrthoFinder 1 1.000 FOG0001776
orthoMCL 1 0.900 OOG5_127620
Panther 1 1.100 P PTHR11452
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R31
98.870

Return to query results.
Submit another query.