DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and cftr

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001038348.1 Gene:cftr ZFINID:ZDB-GENE-050517-20 Length:1485 Species:Danio rerio

Alignment Length:2023 Identity:421/2024 (21%)
Similarity:738/2024 (36%) Gaps:662/2024 (33%)


  Fly   226 ATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSA-------RSHYDHFLYIYTEKKKKSNS 283
            |...|:..|||..|::..|:||.|...|:.|...:|:|       ...:|..:   ...|||.:.
Zfish     9 ANCLSRYFFWWTNPIMRKGFKEKLRPSDVYQAPSQDAADILAERLEKEWDREV---ASGKKKPSL 70

  Fly   284 SPSLWYCYIKNSWQMFALGGILKLAGDLFALIGPLAIQKIVEYIEQLYAQASEPPAKSPGNEVAN 348
            ..::..||||    .|.|.|.|...|:....:.|..:.:|:         ||..||..|..    
Zfish    71 LRAMARCYIK----PFLLFGFLLYIGEATKTVQPQLLGRII---------ASFDPAHEPER---- 118

  Fly   349 VLLSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLLANGWCIAWIVLLAAITQGALSQASTHILNM 413
                                               |||:.:|:.:.|....:..|.|.:...|:.
Zfish   119 -----------------------------------ANGYFLAFGLGLLFTARFLLLQPAMFGLHH 148

  Fly   414 TGIRIKTSLQGLIYRKSLLLNA---DGGCDSSDSAGQVQSTSSTSDEKQKNDDSMATPEHVDNPS 475
            .|::|:.:|..:||:|:|.|::   |     ..|.||:.|..|.:  ..|.|.|:.         
Zfish   149 LGMQIRIALFSIIYKKTLKLSSRVLD-----KISTGQLVSLMSAN--LGKFDQSLG--------- 197

  Fly   476 EPNISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLYMNLGISAVIGSIACIVIM 540
                                       :.|:.|..|.:..:...|::..:.:::.. ::|.|.::
Zfish   198 ---------------------------MAHFIWISPLQCILCTGLIWELIDVNSFC-ALAAISLL 234

  Fly   541 TPLQFFIGNAMS--KNAEVIAGYTDERLKRIHDTLVGIKVIKLNAWDEVFLKKIQEARRKE---- 599
            ..||.|:.:.|.  |..:|:  .|::||....:.:..:..:|...|:|:....|:..|:.|    
Zfish   235 GVLQAFLSHKMGPYKAQKVL--LTNKRLALTSEIMENLHSVKAYGWEEIMETLIKNIRQDEVKLT 297

  Fly   600 -----LKYLNKDATFWTLMAVLTHIATVLITFVTLGVYVWLHRDQEFDLNASRLFSSLALFQQLT 659
                 |:|....|.|::  |:...:|.|:...::.|:            |..|:|::|:.     
Zfish   298 RKIGSLRYFYSSAYFFS--AIFVIVAAVVPHALSRGI------------NLRRIFTTLSY----- 343

  Fly   660 VPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARI---LSKSDASLDMYETQEKS 721
              .::..:||         ||:|     ...||..::.:|.:.:|   |||.:..|..|:     
Zfish   344 --CMVLRMTV---------TRQL-----PGSIQMWYDTMRLIWKIEEFLSKEEYKLMEYD----- 387

  Fly   722 NMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGHNKLVQQRREL 786
                                              |...|...:|::.|.                
Zfish   388 ----------------------------------LSITELELQDVTASW---------------- 402

  Fly   787 LRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSINDGLFTWQPQSQ 851
                       .:..|.::||      |:..|..:...:.             :.|||       
Zfish   403 -----------DEGPGELLER------IKQENKANGHHNG-------------DAGLF------- 430

  Fly   852 MPVVQLHVPGII------VPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTISYVS 910
              ...|:|..::      :.||::..|.|..||||:|||..:|.|:...:|.:  ..:..|||.|
Zfish   431 --FTNLYVAPVLKDISLKLKKGEMLAVTGSMGSGKSSLLMTILGELVPSSGKI--RHSGRISYSS 491

  Fly   911 QQPWLLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRIA 975
            |..|::..|||:|||||.::...||..|::||.|:.|:..:|..|.:.:.|.|:|:||||:.|:|
Zfish   492 QTAWIMPGTIRDNILFGLTYDEYRYKSVVKACQLEEDLAALPEKDKTPMAEGGLNLSGGQKARVA 556

  Fly   976 IARAIYSSANVVIMDDPLASLDNEVGEHIFQHCIREMLQKSNRTFILVTQQLHRIKEAEYLIAIK 1040
            :|||:|..|::.::|.|...||....:.||..|:.:::  :::|.||||.::..:|.|:.::.:.
Zfish   557 LARAVYRDADLYLLDAPFTHLDIATEKEIFDKCLCKLM--ASKTRILVTNKIEHLKRADKILLLH 619

  Fly  1041 DGRVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNVSKLGLQRS 1105
            :|.....|::.:::..:|    ::::::                               |||   
Zfish   620 NGESFFYGTFPELQSERP----DFSSLL-------------------------------LGL--- 646

  Fly  1106 ISVTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRKRSSIYGSR 1170
                         :|.|.   ||.....|.:.|...:|||....|        :|.:||:.   |
Zfish   647 -------------EAYDN---ISAERRCSILTETLHRVSVDESAG--------MQPERSAF---R 684

  Fly  1171 HLMYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSISGDVLSRS 1235
            .:....|:.|||.:. .||:.|                         |....::|.|.       
Zfish   685 QVPPTKPMYIDERKA-SVIVNP-------------------------LGVARKASFIQ------- 716

  Fly  1236 VLATSCSSYAESSVDGGDLATAAPEPRVQSWQPPQHVTHHQPLSRNASSPPAMEVANPDVKKSEE 1300
                                  .||..|:...|          .|..|..|..|:.:.....|:.
Zfish   717 ----------------------VPEEEVRRTLP----------DRKFSLVPENELVDESFMGSDV 749

  Fly  1301 ARRSNTSSESPLDDHVRGSFQQFLRRMS----MRRSNKPKNHHHPLSATNSILSISEESPPVVHF 1361
            ......        |:.|.     ||.|    |..:.......|..|:....||:         .
Zfish   750 YHNHGV--------HMAGQ-----RRQSVLAFMTNAQGQGRREHLQSSFRRRLSV---------V 792

  Fly  1362 PASILATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSPADQEQHNERH 1426
            |.|.||::               ::|.::..:    |:.|..:......|:.:...|:....|  
Zfish   793 PQSELASE---------------LDIYTRRLS----DSTYDMTGILEEENIEACLTDEIDEIE-- 836

  Fly  1427 VLAEVAGESGRESMPLARLAIDTERKYGKISDDIYLMYIRAAGLPIITIFFITALIWQCLRVYTD 1491
                       |:....:.  :|..:|  :|::..|:|:      :|.|.||.|:  :.......
Zfish   837 -----------ETFETTKW--NTYVRY--VSNNKSLLYV------LIFILFIAAI--EIAGSVAG 878

  Fly  1492 IWL---QQWSNVHGRVASKGHVVLHPSEQDHEVTY---------YFRMYAAISCVCIIMALVSTP 1544
            |:|   :.|...|.|  |:.::..|.:......||         |:.:|..::....::|:    
Zfish   879 IFLITDELWREEHQR--SEPNMTKHSNASSSGQTYAITVTPTSSYYILYIYVATSESLLAM---- 937

  Fly  1545 AGQYAG-------CNARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQR 1602
             |.:.|       ....:.||.|:|..:|...:........|||:|||:.|||.||..:......
Zfish   938 -GFFRGLPFVHTTITISKKLHQKMLHAVLSAPMSVLNTMKTGRIMNRFTKDMATIDDMLPLLMFD 1001

  Fly  1603 LLQFTLLCLSAILINVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVISHLSET 1667
            .:|.|::.:..||:...:.|:|.:...|:...:.:::|::..:.::|:::|....||:.|||..:
Zfish  1002 FVQLTVVVVGCILVVSIVRPYIFLAATPLAIIFIVMRKYFLRTGQQLKQLETEARSPIFSHLIMS 1066

  Fly  1668 IQGVTTIRAFNQQTRFTEILFKRLEANTIAYALLNTSHRWLGVSLDYLGGCIVFVATVTALTAAS 1732
            ::|:.|||||.:|..|..:..|.|..:|..:.|..::.||.....|.|   .||..|:.|..|..
Zfish  1067 LKGLWTIRAFERQAYFEALFHKTLNTHTATWFLYLSTLRWFLFRADIL---FVFFFTLAAWIAVG 1128

  Fly  1733 VSCRRHYEATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADM 1797
            .:                                :..|..:|:.|...:|:.....|.|.....:
Zfish  1129 TN--------------------------------QDKPGEIGIIICLAMLILGTFQWCVATSIAV 1161

  Fly  1798 EMYAGSVERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGA 1862
            :....||:|:..:                                   :|..|::...||     
Zfish  1162 DGMMRSVDRVFKF-----------------------------------IDLPSETPKPDK----- 1186

  Fly  1863 TTAAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHHPPATAG 1927
                                                                             
Zfish  1187 ----------------------------------------------------------------- 1186

  Fly  1928 DKVEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYE 1992
                                   .||..:::.|..|:       ...|||.||.|...|::::|.
Zfish  1187 -----------------------GKDSDLIIENVDAQ-------ADSSWPHRGQIEVRNLTVKYT 1221

  Fly  1993 GQKQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRT 2057
            .....|:.||:......||:||.||||||||||..:|..::.|. |.|.||.|:..::...:.|.
Zfish  1222 EAGHAVLKNLSFSAEGRQRVGILGRTGSGKSSLFNALLKLVYTD-GEISIDGVNWNKMPLQKWRK 1285

  Fly  2058 RLSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICDGGLNLSA 2122
            ...::||.|.:|...:|.||||:|...|.:||...|...||..:. ..|..||..:..||..||.
Zfish  1286 AFGVVPQKVFIFTGPLRMNLDPYGCHSDEELWRVAEEVGLKTVIE-QFPDKLDFQLEYGGYVLSN 1349

  Fly  2123 GHRQLLCLARAILRGSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITIAHRLTTILDYDRL 2187
            ||:||:||||:||.|:..|:|||.::.||..|...|.|....:|...||:...|::..:|:....
Zfish  1350 GHKQLICLARSILSGARILLLDEPSAHLDPVTIKVLKKTLRQSFSTCTILLSEHKVEPLLECQSF 1414

  Fly  2188 IVLDQGRI 2195
            :::|:|::
Zfish  1415 LMMDKGQV 1422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
cftrNP_001038348.1 AAA 1..1485 CDD:333001 421/2024 (21%)
Intrinsically disordered R region. {ECO:0000250|UniProtKB:P13569} 653..826 48/290 (17%)
PDZ-binding. {ECO:0000250|UniProtKB:P13569} 1483..1485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.