DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and CG5789

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001247286.1 Gene:CG5789 FlyBaseID:FBgn0039207 Length:1402 Species:Drosophila melanogaster

Alignment Length:2101 Identity:473/2102 (23%)
Similarity:752/2102 (36%) Gaps:841/2102 (40%)


  Fly   226 ATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSA----------------RSHYDHFLYIY 274
            |...|:..|.|..|||:.|.:..|..:||.|...||.:                |||        
  Fly    16 ANIISQLIFAWAIPLLYRGSRRGLNTDDLTQCLKEDRSEQLGDRLEDQWFKELERSH-------- 72

  Fly   275 TEKKKKSNSSPSLWYCYIKNSWQMFALGGILKLAGDLFALIGPLAIQKIVEYI------------ 327
             .||:|.:...:|:.|:                       :||..|..::.:|            
  Fly    73 -RKKQKPHLRNALFRCF-----------------------LGPTIINGLICFIYIVIKTLIPAVL 113

  Fly   328 EQLYAQASEPPAKSPGN------EVANVLLSTSRIL-------------GTEFDEVFGTNIDK-- 371
            .||..|..:.|.....|      .:::.|..|:|.:             |:..|.:|..::||  
  Fly   114 AQLLIQFQKTPVAQLRNIDVNDISISDSLNRTARAIPNYVLSQAVANSSGSPGDALFPKSLDKAG 178

  Fly   372 ------------------VR-IYSST----WSDLLANGWCIAWIVLLAAITQGALSQASTHILNM 413
                              || |...|    |:|:.:.|   |.:||........|...... ..:
  Fly   179 PLEPIQPPVEEVDHNATAVRSILDQTVEHMWNDMNSLG---AVLVLSTLFCCFLLHHVDLR-QRL 239

  Fly   414 TGIRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQSTSSTSDEKQKNDDSMATPEHVDNPSEPN 478
            .|.|::.:...|||||:|.|       |..:|||                   ||          
  Fly   240 MGARMRIACCSLIYRKTLRL-------SMKTAGQ-------------------TP---------- 268

  Fly   479 ISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLYMNLGISAVIGSIACIVIMTPL 543
                .|.:.|.::.|...:...|:.:|:.|.:|.:..:..||:::|:||.|::|.:..::...|:
  Fly   269 ----AGYLINLLSNDVNRLDYGFIFMHWIWIMPLQAMLTCYLIWLNIGIPAIVGVVGLLLKTVPV 329

  Fly   544 QFFIGNAMSKNAEV----IAGYTDERLKRIHDTLVGIKVIKLNAWDEVFLKKIQEARRKELK--- 601
            |    .|:||...|    ||..||.|:..:::.:.||:|||:.||::.|...:.||||.|:|   
  Fly   330 Q----TALSKVTSVLRMRIAERTDARVGIMNELVQGIQVIKMYAWEKPFQAVVAEARRSEIKQIR 390

  Fly   602 YLNKDATFWTLMAVLTHIATVLITFVT---LGVYVWLHRDQEFDLNASRLFSSLALFQQLTVPLL 663
            |.:....|:....|.|..:|:.||...   :|..:    ..:|..:|:..::.|.|     |..:
  Fly   391 YASYLRGFYLSTMVFTERSTLYITLAAAALMGQTI----TADFVFSAASYYNILQL-----VAAI 446

  Fly   664 IFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSDASLDMYETQEKSNMTMRTA 728
            .:|:.|.....|.||.||::.||                                          
  Fly   447 WYPLAVSFGAEALVSLRRIQDFL------------------------------------------ 469

  Fly   729 QAENRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGHNKLVQQRRELLRNTPYV 793
                                      :|:..||..:.::....||.|                  
  Fly   470 --------------------------MLEGREERTQGLTHKRDQEGG------------------ 490

  Fly   794 AIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSINDGLFTW---QPQSQMPVV 855
                                                   |..||:|.|...:|   :||..:..:
  Fly   491 ---------------------------------------DSRAVTIKDINASWDIEKPQKTLQSI 516

  Fly   856 QLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTISYVSQQPWLLNDTI 920
            .|.     :.||:|..|:|..|:||:|:|..||.|:|::.|.:|...  .:||.:|:|||...::
  Fly   517 NLQ-----IEKGQLCAVIGPVGAGKSSILQLLLGELPVIDGGVFIQG--DLSYAAQEPWLFTGSV 574

  Fly   921 RENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRIAIARAIYSSAN 985
            |.||||||.|..|||..|...|||..|.:.:|.||.:::||||.::|||||.||::|||:|..|.
  Fly   575 RNNILFGEEFDRKRYQEVTRCCALSTDFQQLPNGDKTLVGERGASLSGGQRARISLARAVYKPAQ 639

  Fly   986 VVIMDDPLASLDNEVGEHIFQHCI--REMLQKSNRTFILVTQQLHRIKEAEYLIAIKDGRVEACG 1048
            :.:|||||:::|..||.|:|...|  |..|.:...|.||||.|:|.:.||:.::.:..||:...|
  Fly   640 IYLMDDPLSAVDAHVGRHLFDEVIGPRGRLAQLKATRILVTHQVHFLSEADVIVIVDQGRILRQG 704

  Fly  1049 SYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNVSKLGLQRSISVTMDAN 1113
            :|.::      |.::.:....:.:.|.:...:|...:|:                 .:||     
  Fly   705 TYQEL------INSDLDFARLLERPKEEEEGENSRNQTS-----------------PLSV----- 741

  Fly  1114 VACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRKRSSIYGSRHLMYDVPL 1178
                                 |.:|.||: .:.: |.....|...|:::.||::||:.|      
  Fly   742 ---------------------NSLESDDE-DIPF-IDGVKDGYQQLRKQSSSVHGSKSL------ 777

  Fly  1179 PIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSISGDVLSRSVLATSCSS 1243
              |..|.||                                                        
  Fly   778 --DSTQLDD-------------------------------------------------------- 784

  Fly  1244 YAESSVDGGDLATAAPEPRVQSWQPPQHVTHHQPLSRNASSPPAMEVANPDVKKSEEARRSNTSS 1308
                :||..|||                                            ||:.|...|
  Fly   785 ----NVDEDDLA--------------------------------------------EAQASGGIS 801

  Fly  1309 ESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSISEESPPVVHFPASILATDGNKN 1373
                                      |:..:....|.:::||.|        |...::..     
  Fly   802 --------------------------PRVWYEYFHAGSTLLSFS--------FMVFVMVM----- 827

  Fly  1374 ETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSPADQEQHNERHVLAEVAGESGRE 1438
                              :.:.|       |..:..||:.:    |::|                
  Fly   828 ------------------SQVVC-------SSSDFFANIWT----QQEH---------------- 847

  Fly  1439 SMPLARLAIDTERKYGKISDDIY-LMYIRAAGLPIITIFFITALIWQCLRVYTDIWLQQWSNVHG 1502
                       :|..|:.:...: .|||  .|..||.:..:|..                     
  Fly   848 -----------QRSQGEATFSTFECMYI--YGALIIAVVIMTTF--------------------- 878

  Fly  1503 RVASKGHVVLHPSEQDHEVTYYFRMYAAISCVCIIMALVSTPAGQYAGCNARRNLHDKLLQTILH 1567
                :|.:             :|:       :|:               :|.:.|||::...|||
  Fly   879 ----RGFL-------------FFK-------ICM---------------HASKVLHDRMFACILH 904

  Fly  1568 KTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQRLLQFTLLCLSAILINVTITPWILVLTLPIC 1632
            .|:.||..||.|||:||||.||..||:.:.......:|..|:....:::...:.|.::...|.:.
  Fly   905 ATMRFFDTTPSGRILNRFSKDMGAIDELLPRAMMDFIQIALVMFGILIVIGILNPVLVAAMLVVA 969

  Fly  1633 GAYYLIQKFYRCSARELQRIENATNSPVISHLSETIQGVTTIRAFNQQTRFTEILFKRL----EA 1693
            ....||.|.|...:::|:|:|....|||.||||.::.|:..||:...|    :::.|..    :.
  Fly   970 VVDVLILKLYLRPSQDLKRLEGICRSPVFSHLSASLTGLAIIRSRQLQ----DVVAKEFDLLQDV 1030

  Fly  1694 NTIAYALLNTSHRWLGVSLDYLGGCI--VFVATVTALTAASVSCRRHYEATTSPSASASPSPFET 1756
            ::..:.|....:..||:.||    |:  :|:.:||.....|      .|.|.|.:          
  Fly  1031 HSSVWQLTMAVNTTLGLWLD----CVSCIFLTSVTFSFIIS------SETTYSGN---------- 1075

  Fly  1757 YAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADMEMYAGSVERIAHYAQGQDADADAD 1821
                            |||||...:::...:.:.|:.:|:......||||:..|           
  Fly  1076 ----------------VGLAIAQAMILTGMVQYGVRQVAESLQQMTSVERVLQY----------- 1113

  Fly  1822 ADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGATTAAGDVDEDGDQQRIGGARGGGG 1886
                    .:|:.||:..|                                              
  Fly  1114 --------TELEQEPALGE---------------------------------------------- 1124

  Fly  1887 DCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHHPPATAGDKVEQATTKTSVIKDKQLPPQQDD 1951
                                                             ||        ||||  
  Fly  1125 -------------------------------------------------KT--------PPQQ-- 1130

  Fly  1952 KDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICG 2016
                                    ||.||.:.|.|:|.||:.....|:.||.|.|.||.::||.|
  Fly  1131 ------------------------WPTRGQVEFRNMSCRYDPNGSPVLRNLNLTIEAGWKVGIVG 1171

  Fly  2017 RTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRTRLSIIPQDVHLFNATIRENLDPHG 2081
            |||:|||||..:||. |....|.|:||.::...|..:.||||:||||||..||:||||.||||..
  Fly  1172 RTGAGKSSLIGALFR-LAHIEGEIFIDGIETGTISLEILRTRISIIPQDPVLFSATIRYNLDPFE 1235

  Fly  2082 YFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICDGGLNLSAGHRQLLCLARAILRGSVCLVLDEA 2146
            .:.|.:||:.||..:|::.:.     |||.::.:.|.|.|.|.||||||||||||.:..||||||
  Fly  1236 RYTDAELWSALEDVELRKAIP-----GLDYMVTERGGNFSVGQRQLLCLARAILRNNKVLVLDEA 1295

  Fly  2147 TSVLDSSTESALLKAADLAFRGRTIITIAHRLTTILDYDRLIVLDQGRIVE-----------DGN 2200
            |:.:|..|::.:.:...:.|:..|::|:||||.|::|.||:||:|.|..||           .|:
  Fly  1296 TANVDPQTDALIQRTIRIKFKQCTVLTVAHRLHTVMDSDRIIVMDAGVAVEFDVPYLLLKKSQGH 1360

  Fly  2201 PRELQQLEGSVFRGLLEKGAS 2221
            .|::.:..|..... |:|.||
  Fly  1361 LRQMVEATGGESEA-LKKTAS 1380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
CG5789NP_001247286.1 CFTR_protein 9..1367 CDD:273530 468/2086 (22%)
ABC_membrane 214..441 CDD:294371 70/279 (25%)
ABCC_MRP_domain1 495..699 CDD:213217 87/211 (41%)
ABC_membrane 863..1088 CDD:294371 73/327 (22%)
ABCC_MRP_domain2 1135..1350 CDD:213211 103/221 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24223
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.