DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and ABCC6

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:XP_024306029.1 Gene:ABCC6 HGNCID:57 Length:1515 Species:Homo sapiens

Alignment Length:2249 Identity:490/2250 (22%)
Similarity:765/2250 (34%) Gaps:849/2250 (38%)


  Fly    43 IFLLLFGLMFVCSRYKKCHKTLLTFHNGR--------------AAISLLLLALNSFDLARIFLPH 93
            ::|.:.|.:::          |...|:||              |||...|...|....|.|.|..
Human    42 MYLWVLGPIYL----------LFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNVLGFALIVLCT 96

  Fly    94 QNVR-NLNRLFQSSPRDLNYLVVIGSGELWNALFSTLLTLMLMLYHRMVERKK-----ATVFLY- 151
            .:|. .|.::.|.:|....:|:   ...:|    .|.::..:.|.|  .||||     ..:|.| 
Human    97 SSVAVALWKIQQGTPEAPEFLI---HPTVW----LTTMSFAVFLIH--TERKKGVQSSGVLFGYW 152

  Fly   152 -------ASTAVEALTFALLSNELFELVRYEDFLELQTCLVAMSAMCMVSLAMLDGLTVYKECYH 209
                   |:.|.:..:.|...:   :.||:   |....||..:.|..::| .:.|....:.|   
Human   153 LLCFVLPATNAAQQASGAGFQS---DPVRH---LSTYLCLSLVVAQFVLS-CLADQPPFFPE--- 207

  Fly   210 DDYLDDYGKIGYKHSMATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDS------------ 262
                |.........:.|.|.||:.|||::.|:|.||:.||..:||..:..|:|            
Human   208 ----DPQQSNPCPETGAAFPSKATFWWVSGLVWRGYRRPLRPKDLWSLGRENSSEELVSRLEKEW 268

  Fly   263 ------ARSHYDHFLYIYTEKKKKSNS---SP----------SLWYCYIKNSWQM----FALGGI 304
                  ||.|.....:     |:|..|   :|          |.|...:|..||:    |.||.:
Human   269 MRNRSAARRHNKAIAF-----KRKGGSGMKAPETEPFLRQEGSQWRPLLKAIWQVFHSTFLLGTL 328

  Fly   305 LKLAGDLFALIGPLAIQKIVEYIEQLYAQASEPPAKSPGNEVANVLLSTSRILGTEFDEVFGTNI 369
            ..:..|:|....|..:...:|:|..     .:|||                              
Human   329 SLIISDVFRFTVPKLLSLFLEFIGD-----PKPPA------------------------------ 358

  Fly   370 DKVRIYSSTWSDLLANGWCIAWIVLLAAITQGALSQASTHILNMTGIRIKTSLQGLIYRKSLLLN 434
                     |     .|:.:|.::.|:|..|....|.:.:.|.:..:|:::::.||:|||.|.| 
Human   359 ---------W-----KGYLLAVLMFLSACLQTLFEQQNMYRLKVLQMRLRSAITGLVYRKVLAL- 408

  Fly   435 ADGGCDSSDSAGQVQSTSSTSDEKQKNDDSMATPEHVDNPSEPNISHDIGSITNHMTEDTRNIME 499
                     |:|..::::                              :|.:.|.::.|.:.:.|
Human   409 ---------SSGSRKASA------------------------------VGDVVNLVSVDVQRLTE 434

  Fly   500 FFLIIHYAWAIPFKIAVVIYLLYMNLGISAVIGSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDE 564
            ..|.::..|.....|.|....|:..||.|| :.:||..:.:.||.|||....:.:.|......|.
Human   435 SVLYLNGLWLPLVWIVVCFVYLWQLLGPSA-LTAIAVFLSLLPLNFFISKKRNHHQEEQMRQKDS 498

  Fly   565 RLKRIHDTLVGIKVIKLNAWDEVFLKKIQEARRKELKYLNKDATFWTLMAVLTHIATVLITFVTL 629
            |.:.....|...|.||.:.|:..||.::...|.:||..|......:::..|...::|.|:..|..
Human   499 RARLTSSILRNSKTIKFHGWEGAFLDRVLGIRGQELGALRTSGLLFSVSLVSFQVSTFLVALVVF 563

  Fly   630 GVYVWLHRDQEFDLNASRLFSSLALFQQLTVPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQ 694
            .|:..:   .|..:||.:.|.:|.:...|.......|.::..::.||||..||..||        
Human   564 AVHTLV---AENAMNAEKAFVTLTVLNILNKAQAFLPFSIHSLVQARVSFDRLVTFL-------- 617

  Fly   695 FEGIRNMARILSKSDASLDMYETQEKSNMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNA 759
                                                                             
Human   618 ----------------------------------------------------------------- 617

  Fly   760 EESAEDISPSTVQELGHNKLVQQRRELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRR 824
              ..|::.|..|..                         ...||            |...|    
Human   618 --CLEEVDPGVVDS-------------------------SSSGS------------AAGKD---- 639

  Fly   825 DSLLLKMPDDIAVSINDGLFTWQPQSQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLM 889
                       .::|:...|.|..:|. |.  ||...:.||:|.|..|||..|:||:|||||||.
Human   640 -----------CITIHSATFAWSQESP-PC--LHRINLTVPQGCLLAVVGPVGAGKSSLLSALLG 690

  Fly   890 EMPLLAGNMFWHKTCTISYVSQQPWLLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRG 954
            |:..:.|  |......::||.|:.|:.|.::.||:.||:...|...:.|||||||:||::..|.|
Human   691 ELSKVEG--FVSIEGAVAYVPQEAWVQNTSVVENVCFGQELDPPWLERVLEACALQPDVDSFPEG 753

  Fly   955 DLSIIGERGINISGGQRQRIAIARAIYSSANVVIMDDPLASLDNEVGEHIFQHCIRE--MLQKSN 1017
            ..:.|||:|:|:||||:||:::|||:|..|.|.::|||||:||..||:|:|...|..  :||.:.
Human   754 IHTSIGEQGMNLSGGQKQRLSLARAVYRKAAVYLLDDPLAALDAHVGQHVFNQVIGPGGLLQGTT 818

  Fly  1018 RTFILVTQQLHRIKEAEYLIAIKDGRVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNP 1082
            |  ||||..||.:.:|:::|.:.:|.:...|||.  ||:|.:     .|::.:.     :.::.|
Human   819 R--ILVTHALHILPQADWIIVLANGAIAEMGSYQ--ELLQRK-----GALMCLL-----DQARQP 869

  Fly  1083 GEKTAGERWKLLKNVSKLGLQRSISVTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSY 1147
            |::..|                                                 |.:...|...
Human   870 GDRGEG-------------------------------------------------ETEPGTSTKD 885

  Fly  1148 PIGNASCGGFNLQRKRSSIYGSRHLMYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRL 1212
            |.|.::                                             |||           
Human   886 PRGTSA---------------------------------------------GRR----------- 894

  Fly  1213 SGLSTLTATSESSSISGDVLSRSVLATSCSSYAESSVDGGDLATAAPEPRVQSWQPPQHVTHHQP 1277
                                                          ||.|.:             
Human   895 ----------------------------------------------PELRRE------------- 900

  Fly  1278 LSRNASSPPAMEVANPDVKKSEEARRSNTSSESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPL 1342
              |:..|.|           .::...|...:|.||||                            
Human   901 --RSIKSVP-----------EKDRTTSEAQTEVPLDD---------------------------- 924

  Fly  1343 SATNSILSISEESPPVVHFPASILATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKE 1407
                         |....:||                                            
Human   925 -------------PDRAGWPA-------------------------------------------- 932

  Fly  1408 LRANVTSSPADQEQHNERHVLAEVAGESGRESMPLARLAIDTERKYGKISDDIYLMYIRAAGLPI 1472
                                        |::|:           :||::...::|.|:||.|.|:
Human   933 ----------------------------GKDSI-----------QYGRVKATVHLAYLRAVGTPL 958

  Fly  1473 ITIFFITALIWQCLRVYTDIWLQQWSN---VHG---RVASKGHVVLHPSEQDHEVTYYFRMYAAI 1531
            ........|..|........||..|::   |.|   :.|.:|.:                 :..:
Human   959 CLYALFLFLCQQVASFCRGYWLSLWADDPAVGGQQTQAALRGGI-----------------FGLL 1006

  Fly  1532 SCVCIIMALVSTPAGQYAGCNARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKI 1596
            .|:..|....|..|....|..|.|.|..:||..::...:.||:.||:|.::||||.:...:|..|
Human  1007 GCLQAIGLFASMAAVLLGGARASRLLFQRLLWDVVRSPISFFERTPIGHLLNRFSKETDTVDVDI 1071

  Fly  1597 AATGQRLLQFTLLCLSAILINVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVI 1661
            ....:.||.:....|...|:....||...|..||:...|...|..|..|:.:|:|:|:|:.|.|.
Human  1072 PDKLRSLLMYAFGLLEVSLVVAVATPLATVAILPLFLLYAGFQSLYVVSSCQLRRLESASYSSVC 1136

  Fly  1662 SHLSETIQGVTTIRAFNQQTRFTEILFKRL-EANTIAYALLNTSHRWLGVSLDYLGGCIVFVATV 1725
            ||::||.||.|.:|||..|..|......|: |:..|::..| .:.|||..:::.||..:||.|..
Human  1137 SHMAETFQGSTVVRAFRTQAPFVAQNNARVDESQRISFPRL-VADRWLAANVELLGNGLVFAAAT 1200

  Fly  1726 TALTAASVSCRRHYEATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWV 1790
            .|:.                                  |:...|..|||.:::..|.|...|.||
Human  1201 CAVL----------------------------------SKAHLSAGLVGFSVSAALQVTQTLQWV 1231

  Fly  1791 VKLLADMEMYAGSVERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAG 1855
            |:...|:|....||||:..||.                                           
Human  1232 VRNWTDLENSIVSVERMQDYAW------------------------------------------- 1253

  Fly  1856 DKVYPGATTAAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFH 1920
                                                                             
Human  1254 ----------------------------------------------------------------- 1253

  Fly  1921 HPPATAGDKVEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFD 1985
                                                 .|.|...:|....:.| .|||.|.|.|.
Human  1254 -------------------------------------TPKEAPWRLPTCAAQP-PWPQGGQIEFR 1280

  Fly  1986 NVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRI 2050
            :..|||..:....:..::.||.||:::||.||||:|||||...|..:.:...|.|:||.|.|..:
Human  1281 DFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHV 1345

  Fly  2051 RPDELRTRLSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICD 2115
            ....||:|:||||||..||..::|.|||......|..:|..||..|||..| ..||..|.....|
Human  1346 GLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALV-ASLPGQLQYKCAD 1409

  Fly  2116 GGLNLSAGHRQLLCLARAILRGSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITIAHRLTT 2180
            .|.:||.|.:||||||||:||.:..|:|||||:.:|..||..:.......|...|::.|||||.:
Human  1410 RGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRS 1474

  Fly  2181 ILDYDRLIVLDQGRIVEDGNPRELQQLEGSVFRGLLEKG 2219
            ::|..|::|:|:|::.|.|:|.:|...:|..:|...|.|
Human  1475 VMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESG 1513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
ABCC6XP_024306029.1 SunT 14..1514 CDD:331423 490/2250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.