DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and abcc5

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001182542.1 Gene:abcc5 ZFINID:ZDB-GENE-050517-17 Length:1426 Species:Danio rerio

Alignment Length:2050 Identity:458/2050 (22%)
Similarity:736/2050 (36%) Gaps:750/2050 (37%)


  Fly   214 DDYGKIGYKHSM------------------ATFYSKSCFWWLTPLLWLGYKE-PLELEDLGQMKL 259
            |..|:..|.||:                  |..:|...|.|||.|..|.:|: .|.|||:..:..
Zfish    69 DAAGRSKYHHSVCVLKPIRSTSKYQHPVDNAGLFSFMTFNWLTSLAVLAHKKGQLFLEDIWAVSQ 133

  Fly   260 EDSARSHYDHFLYIYTEKKKKSNSSPSL----W-YCYIKNSWQMFALGGILKLAGDLFALIGP-L 318
            .:|...:......::.|:.:...:..||    | :|..:....:..| .:.:|||    ...| .
Zfish   134 FESCEINRRRLAGLWEEEIRSRGNDASLRRVVWHFCRTRLLLSILCL-MVTQLAG----FSSPAF 193

  Fly   319 AIQKIVEYIEQLYAQASEPPAKSPGNEVANVLLSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLL 383
            .:.:::|     |.|.|||       ::...||....:|.||                      |
Zfish   194 VVWRLLE-----YTQRSEP-------DLPYGLLLVLGLLATE----------------------L 224

  Fly   384 ANGWCIAWIVLLAAITQGALSQASTHILN-MTGIRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQ 447
            ...|                |.|.|..|| .||.|::.::..:.:.|.|.|              
Zfish   225 IRSW----------------SHALTWALNYRTGTRLRGAILTMAFHKILRL-------------- 259

  Fly   448 VQSTSSTSDEKQKNDDSMATPEHVDNPSEPNISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPF 512
                      :...:.||                  |.:.|..:.|.:.:.|...:.......|.
Zfish   260 ----------RSLREKSM------------------GELINMCSGDGQRMFEAAAVGSLLAGGPL 296

  Fly   513 KIAV--VIYLLYMNLGISAVIGSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDERLKRIHDTLVG 575
             :||  :.|.|:: ||.::::|| |..::..|...|.....:.........||:|::::::.|..
Zfish   297 -VAVLGMAYNLFV-LGPTSLLGS-AVFILFYPTMMFSSRLTAYFRRKGVAVTDQRVQKMNEILNY 358

  Fly   576 IKVIKLNAWDEVFLKKIQEARRKELKYLNKDATFWTLMAVLTHIATVLITFVTLGVYVWLHRDQE 640
            ||.||:.||.:.|.:.::..|.:|.:.|.:...|.::...:..|..|:.:..|...::.|    .
Zfish   359 IKFIKMYAWVKAFSQAVRRIRDEERQILERTGYFQSITVGVAPIVVVIASVATFSTHMLL----G 419

  Fly   641 FDLNASRLFSSLALFQQLTVPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARIL 705
            :||.|::.|:.:.:|..:|..|.:.|.:|..:..|.|:..|.:..|..:|::...|..||.:..:
Zfish   420 YDLTAAQAFTVVTVFNAMTFALKVTPFSVKSLSEASVAIDRFKSLLLMAEVKMIRELPRNPSVAV 484

  Fly   706 SKSDASLDMYETQEKSNMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPST 770
            ..|.||| .:||...|                  ||.|.                          
Zfish   485 EMSGASL-AWETGGHS------------------AQPSP-------------------------- 504

  Fly   771 VQELGHNKLVQQRRELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDI 835
                             |.||:|..|..:.:....:.|...:::....     ...||..:..::
Zfish   505 -----------------RGTPHVGTRGCRKKRRQRDVPKHHAILEEET-----HGQLLNDVSGEM 547

  Fly   836 AVSINDGLFTWQPQSQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFW 900
            |.|..|........||.....||...:.:.||||..|.|..|||||||:||:|.:|.||.|    
Zfish   548 ASSPKDQTLHVPTISQRLQRTLHCIDLSIQKGKLVGVCGSVGSGKTSLISAILGQMTLLEG---- 608

  Fly   901 HKTCTI----SYVSQQPWLLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGE 961
              |..:    :||:||.|:||.:.|:|||||:....:||..:|.||.|:||:.::|.|||:.|||
Zfish   609 --TVAVDGDFAYVAQQAWILNASFRDNILFGKEMEEERYQAILSACCLRPDLAMLPSGDLTEIGE 671

  Fly   962 RGINISGGQRQRIAIARAIYSSANVVIMDDPLASLDNEVGEHIFQHCIREMLQKSNRTFILVTQQ 1026
            ||.|:||||||||::|||:||:..:.|:||||::||..||.|||.:.|::.|:  .:|.|.||.|
Zfish   672 RGANLSGGQRQRISLARALYSNRGIYILDDPLSALDAHVGNHIFNNAIKKQLR--GKTVIFVTHQ 734

  Fly  1027 LHRIKEAEYLIAIKDGRVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERW 1091
            |..:.:.:.:|.::||.:...||:.|:..:.....|.:|                          
Zfish   735 LQYLVDCDDVIVMRDGSIAEQGSHEDLMNVNGDYAAMFN-------------------------- 773

  Fly  1092 KLLKNVSKLGLQRSISVTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGG 1156
                                                                             
Zfish   774 ----------------------------------------------------------------- 773

  Fly  1157 FNLQRKRSSIYGSRHLMYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTAT 1221
             |||                                     ||                      
Zfish   774 -NLQ-------------------------------------LG---------------------- 778

  Fly  1222 SESSSISGDVLSRSVLATSCSSYAESSVDGGDLATAAPEPRVQSWQPPQHVTHHQPLSRNASSPP 1286
                                                                          ..|
Zfish   779 --------------------------------------------------------------ETP 781

  Fly  1287 AMEVANPDVKKSEEARRSNTSSESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSI 1351
            .:||.|         ::|.:|.:.||:....||.::                             
Zfish   782 IIEVPN---------KKSGSSLKKPLEKSKAGSVKK----------------------------- 808

  Fly  1352 SEESPPVVHFPASILATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSP 1416
             |:|           .|.|:....|.||:                                    
Zfish   809 -EKS-----------TTQGDGQLMQVEER------------------------------------ 825

  Fly  1417 ADQEQHNERHVLAEVAGESGRESMPLARLAIDTERKYGKISDDIYLMYIRA-AGLPIITIFFITA 1480
                               |:.|:|.|                :|.:||:| .|.|:  ..||.|
Zfish   826 -------------------GKGSVPWA----------------VYKVYIQALGGWPV--FLFILA 853

  Fly  1481 LI------------WQCLRVYTDIWLQQWS-NVHGRVASKGHVVLHPSEQDHE-VTYYFRMYAAI 1531
            |.            |.|      .|::|.| |...:|.:..  ||..|.:|:. :.:|..:|...
Zfish   854 LFILNVGSTAFSNWWLC------YWIKQGSGNTTVQVGNSS--VLSESMRDNPLMQHYAAVYTMS 910

  Fly  1532 SCVCIIMALVSTPAGQYAGCNARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKI 1596
            ..|.:::.|:...........|...|||:|.|.||...:.||..||..||:||||.||..:|.::
Zfish   911 MGVMLLLKLLRGIVFVKGTLRASSRLHDELFQKILRSPMKFFDTTPTARILNRFSKDMDEVDTRL 975

  Fly  1597 AATGQRLLQFTLLCLSAILINVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVI 1661
            ....:...|..:|.|..:.:..::.||.||...|:...:.::....|...|||:|::|.|.||.:
Zfish   976 PFQAEMFTQNVILVLFCLAVIGSVFPWFLVAVGPLVLLFTVLHVVSRVFIRELKRLDNVTQSPFL 1040

  Fly  1662 SHLSETIQGVTTIRAFNQQTRFTEILFKRLEANTIAYALLNTSHRWLGVSLDYLGGCIVFVATVT 1726
            ||::.:|||:||:.|:.::..|.....:.|:.|...:.|.:.:.|||.|.||.:.   |.:.::|
Zfish  1041 SHIASSIQGLTTVHAYGKEDEFLHRYQELLDQNQAPFYLFSCAMRWLAVRLDVIS---VALISIT 1102

  Fly  1727 ALTAASVSCRRHYEATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVV 1791
            ||....:    |.:.                           .|:..||||:|.:.:.....:.|
Zfish  1103 ALMIVLM----HGQI---------------------------PPAYAGLAISYAVQLTGLFQFTV 1136

  Fly  1792 KLLADMEMYAGSVERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGD 1856
            :|.::.|....|||||.||.:....:|                                      
Zfish  1137 RLASETEARFTSVERIHHYIKSLSLEA-------------------------------------- 1163

  Fly  1857 KVYPGATTAAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHH 1921
                                                                             
Zfish  1164 ----------------------------------------------------------------- 1163

  Fly  1922 PPATAGDKVEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDN 1986
                                                    |||  .:.::.|..|||.|:|.||.
Zfish  1164 ----------------------------------------PAR--VKNKAPPSDWPQEGEIVFDQ 1186

  Fly  1987 VSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIR 2051
            ..::|......::...:..:...::|||.|||||||||||:.|:.:::...|.|.||.|:|..|.
Zfish  1187 TEMKYRDNLPLILKKASFTVRPKEKIGIVGRTGSGKSSLGVVLYRLVEPCGGSIKIDGVNICDIG 1251

  Fly  2052 PDELRTRLSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICDG 2116
            ..::|::||||||:..||:.|:|.||||...:.:.|:|:.||...:||.|: .|||.|::.:.:.
Zfish  1252 LADVRSKLSIIPQEPVLFSGTVRSNLDPFSQYSEAQIWDALERTHMKECVS-QLPLKLESEVVEN 1315

  Fly  2117 GLNLSAGHRQLLCLARAILRGSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITIAHRLTTI 2181
            |.|.|.|.|||||:||.:||....|:|||||:.:.:.|:..:.:....||:..|.:|||||:.|:
Zfish  1316 GENFSVGERQLLCVARVLLRQCKILILDEATAAMGTETDCLIQETIRNAFQDCTTLTIAHRVHTV 1380

  Fly  2182 LDYDRLIVLDQGRIVEDGNPRELQQLEGSVFRGLL 2216
            |..||::||:||::||...|.:|...|.|.|..:|
Zfish  1381 LSCDRIMVLNQGQVVEFDEPSKLLANENSRFCAML 1415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
abcc5NP_001182542.1 intraplasmic N-terminal 1..59
transmembrane domain 1 59..149 19/80 (24%)
CFTR_protein 95..1419 CDD:273530 453/2024 (22%)
ABC_membrane 177..441 CDD:294371 72/368 (20%)
nucleotide binding domain 1 188..248 22/110 (20%)
transmembrane domain 2 279..379 24/103 (23%)
nucleotide binding domain 2 403..450 12/51 (24%)
ABCC_MRP_domain1 552..751 CDD:213217 93/207 (45%)
ABC_membrane 851..1132 CDD:294371 85/323 (26%)
ABCC_MRP_domain2 1180..1400 CDD:213211 91/221 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.