DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and Abcc6

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:XP_006541009.1 Gene:Abcc6 MGIID:1351634 Length:1500 Species:Mus musculus

Alignment Length:2122 Identity:425/2123 (20%)
Similarity:680/2123 (32%) Gaps:844/2123 (40%)


  Fly    43 IFLLLFG---LMFVCSRYKKCHKTLLTFHNGRAAISLLLLALNSFDLARIFLPHQNVRNLNRLFQ 104
            ::|.:.|   |::: .|:.:|:..:......:..:.|.|:.|.:|::|   :|      |.|:.|
Mouse   116 MYLWVLGPIYLLYI-HRHGRCYLRMSHLFKTKMVLGLALILLYTFNVA---VP------LWRIHQ 170

  Fly   105 SSPRDLNYLVVIGSGELWNALFSTLLTLMLMLYHRMVERKKATVFLY---------ASTAVEALT 160
            ..|:....|:   ...:|....| ..|.::.:..|...|....:|.|         .:|..:|..
Mouse   171 GVPQAPELLI---HPTVWLTTMS-FATFLIHMERRKGVRSSGVLFGYWLLCCILPGINTVQQASA 231

  Fly   161 FALLSNELFELVRYEDFLELQTCLVAMSAMCMVSLAMLDGLTVYKECYHDDYLDDYGKIGYKHSM 225
            .......|..|..|       .||..:.|..::| .::|....:.|       |.........:.
Mouse   232 GNFRQEPLHHLATY-------LCLSLVVAELVLS-CLVDQPPFFSE-------DSQPLNPCPEAE 281

  Fly   226 ATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSAR------------------SHYDHF-- 270
            |:|.||:.|||.:.|||.|||:.|..:||..:..|:|:.                  .|..|.  
Mouse   282 ASFPSKAMFWWASGLLWRGYKKLLGPKDLWSLGRENSSEELVSQLEREWRRSCNGLPGHKGHSSV 346

  Fly   271 ------LYIYTEKKKKSNSSPSLWYCYIKNSWQMFALGGILKLAGDLFALIGPLAIQKIVEYIEQ 329
                  .::..|:.::.....::|..:...    |.||.:..:..|.|....|..:...:|::  
Mouse   347 GAPETEAFLQPERSQRGPLLRAIWRVFRST----FLLGTLSLVISDAFRFAVPKLLSLFLEFM-- 405

  Fly   330 LYAQASEPPAKSPGNEVANVLLSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLLANGWCIAWIVL 394
                         |:.                             .||.|:     ||.:|.::.
Mouse   406 -------------GDR-----------------------------NSSAWT-----GWLLAVLMF 423

  Fly   395 LAAITQGALSQASTHILNMTGIRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQSTSSTSDEKQ 459
            .||..|....|...:...:..:|::|::.||:|||.|:|          |:|..:|:::      
Mouse   424 AAACLQTLFEQQHMYRAKVLQMRLRTAITGLVYRKVLVL----------SSGSRKSSAA------ 472

  Fly   460 KNDDSMATPEHVDNPSEPNISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLYMN 524
                                    |.:.|.::.|.:.:.|..:.::..|.:...|.|....|:..
Mouse   473 ------------------------GDVVNLVSVDIQRLAESIIYLNGLWLLFLWIFVCFVYLWQL 513

  Fly   525 LGISAVIGSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDERLKRIHDTLVGIKVIKLNAWDEVFL 589
            ||.|| :.::|..:.:.||.|||......:.|........|.:.....|..::.||.:.|:..||
Mouse   514 LGPSA-LTAVAVFLSLLPLNFFITKKRGFHQEEQMRQKASRARLTSSMLRTVRTIKSHGWEHAFL 577

  Fly   590 KKIQEARRKELKYLNKDATFWTLMAVLTHIATVLITFVTLGVYVWLHRDQEFDLNASRLFSSLAL 654
            :::...|.:||..|......:::..|...::|.|:..|...|:..:..|...|  |.:.|.:|.:
Mouse   578 ERLLHIRGQELSALKTSTLLFSVSLVSFQVSTFLVALVVFAVHTLVAEDNAMD--AEKAFVTLTV 640

  Fly   655 FQQLTVPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSDASLDMYETQE 719
            ...|.......|.:|..|:.||||..||..||...|:                           :
Mouse   641 LSILNKAQAFLPFSVHCIVQARVSFDRLAAFLCLEEV---------------------------D 678

  Fly   720 KSNMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGHNKLVQQRR 784
            .:.|                               :..|:..|::|                   
Mouse   679 PNGM-------------------------------IASNSRRSSKD------------------- 693

  Fly   785 ELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSINDGLFTWQPQ 849
                                                               .:|:::|.|.|..:
Mouse   694 ---------------------------------------------------RISVHNGTFAWSQE 707

  Fly   850 SQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTISYVSQQPW 914
            |. |.  ||...:.||:|.|..|||..|:||:|||||||.|:..:.|::....  :::||.|:.|
Mouse   708 SP-PC--LHGINLTVPQGCLLAVVGPVGAGKSSLLSALLGELLKVEGSVSIEG--SVAYVPQEAW 767

  Fly   915 LLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRIAIARA 979
            :.|.::.||:.|.:.........||:||||..|:...|.|..:.|||:|:|:||||:||:::|||
Mouse   768 VQNTSVVENVCFRQELDLPWLQKVLDACALGSDVASFPAGVHTPIGEQGMNLSGGQKQRLSLARA 832

  Fly   980 IYSSANVVIMDDPLASLDNEVGEHIFQHCI--REMLQKSNRTFILVTQQLHRIKEAEYLIAIKDG 1042
            :|..|.:.::|||||:||..|.:.:|:..|  ..:||.:.|  ||||..||.:.:|:.::.:.:|
Mouse   833 VYKKAAIYLLDDPLAALDAHVSQQVFKQVIGPSGLLQGTTR--ILVTHTLHVLPQADRILVLANG 895

  Fly  1043 RVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNVSKLGLQRSIS 1107
            .:...|||.|:                                       |.:|.:.:||     
Mouse   896 TIAEMGSYQDL---------------------------------------LQRNGALVGL----- 916

  Fly  1108 VTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRKRSSIYGSRHL 1172
                         :||:                     ..|.|.                   | 
Mouse   917 -------------LDGA---------------------RQPAGT-------------------H- 927

  Fly  1173 MYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSISGDVLSRSVL 1237
                    |....||                        |.|.                      
Mouse   928 --------DAATSDD------------------------LGGF---------------------- 938

  Fly  1238 ATSCSSYAESSVDGGDLATAAPE-PRVQSWQPPQHVTHHQPLSRNASSPPAMEVANPDVKKSEEA 1301
                        .||...|..|: ||         .|...|:...::|...||.:          
Mouse   939 ------------PGGGRPTCRPDRPR---------PTEAAPVKGRSTSEVQMEAS---------- 972

  Fly  1302 RRSNTSSESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSISEESPPVVHFPASIL 1366
                      |||                                                    
Mouse   973 ----------LDD---------------------------------------------------- 975

  Fly  1367 ATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSPADQEQHNERHVLAEV 1431
                                                                          .|.
Mouse   976 --------------------------------------------------------------PEA 978

  Fly  1432 AGESGRESMPLARLAIDTERKYGKISDDIYLMYIRAAGLPIITIFFITALIWQCLRVYTDIWLQQ 1496
            .|.:..|         |:.| ||::...|||.|:||.|.|:.|......|..|........||..
Mouse   979 TGLTAEE---------DSVR-YGRVKTTIYLSYLRAVGTPLCTYTLFLFLCQQVASFSQGYWLSL 1033

  Fly  1497 WSN---VHGR---VASKGHVVLHPSEQDHEVTYYFRMYAAISCVCIIMALVSTPAGQYAGCNARR 1555
            |::   |.||   .|.:|.|                 :..:.|:..|....|..|....|..|..
Mouse  1034 WADDPVVDGRQMHAALRGWV-----------------FGLLGCLQAIGLFASMAAVFLGGARASG 1081

  Fly  1556 NLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQRLLQFTLLCLSAILINVTI 1620
            .|...||..:....:.||:.||:|.::||||.:...:|..|....:.||.:....|...|.....
Mouse  1082 LLFRSLLWDVARSPIGFFERTPVGNLLNRFSKETDTVDVDIPDKLRSLLTYAFGLLEVGLAVTMA 1146

  Fly  1621 TPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVISHLSETIQGVTTIRAFNQQTRFT- 1684
            ||..:|..||:...|...|..|..::.:|:|:|:|..|.|.||::||.||...:|||..|..|| 
Mouse  1147 TPLAIVAILPLMVLYAGFQSLYVATSCQLRRLESARYSSVCSHMAETFQGSLVVRAFRAQASFTA 1211

  Fly  1685 ----------EILFKRLEANTIAYALLNTSHRWLGVSLDYLGGCIVFVATVTALTAASVSCRRHY 1739
                      .:.|.:|.|:           |||..:|:.||..:||||...|:.          
Mouse  1212 QHDALMDENQRVSFPKLVAD-----------RWLATNLELLGNGLVFVAATCAVL---------- 1255

  Fly  1740 EATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADMEMYAGSV 1804
                                    |:...|..|||.:::..|.|...|.|||:...|:|....:|
Mouse  1256 ------------------------SKAHLSAGLVGFSVSAALQVTQTLQWVVRSWTDLENSMVAV 1296

  Fly  1805 ERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGATTAAGDV 1869
            ||:..||:                                                         
Mouse  1297 ERVQDYAR--------------------------------------------------------- 1304

  Fly  1870 DEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHHPPATAGDKVEQAT 1934
                                                                             
Mouse  1305 ----------------------------------------------------------------- 1304

  Fly  1935 TKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYEGQKQNVI 1999
                                   :|.|...:|....:.|: ||..|.|.|.:..||:..:....:
Mouse  1305 -----------------------IPKEAPWRLPTCAAQPL-WPCGGQIEFRDFGLRHRPELPLAV 1345

  Fly  2000 SNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRTRLSIIPQ 2064
            ..::|||.||:::||.||||:|||||...|..:.:...|:|:||.|.|..:....||:|::||||
Mouse  1346 QGVSLKIHAGEKVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWIDGVPITHVGLHTLRSRITIIPQ 1410

  Fly  2065 DVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLP 2106
            |..||..::|.|||......|..:|..||..|||.||.. ||
Mouse  1411 DPVLFPGSLRMNLDLLQEHTDEGIWAALETVQLKAFVTS-LP 1451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
Abcc6XP_006541009.1 MTABC_N 89..>216 CDD:292803 23/114 (20%)
MRP_assoc_pro 101..1465 CDD:188098 425/2123 (20%)
ABC_membrane 381..645 CDD:294371 68/356 (19%)
ABCC_MRP_domain1 695..896 CDD:213217 81/208 (39%)
ABC_membrane 1014..1279 CDD:294371 82/327 (25%)
P-loop_NTPase 1326..>1465 CDD:304359 53/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.