DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and Abcc12

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_766500.3 Gene:Abcc12 MGIID:2441679 Length:1366 Species:Mus musculus

Alignment Length:2042 Identity:442/2043 (22%)
Similarity:727/2043 (36%) Gaps:765/2043 (37%)


  Fly   213 LDDYGKIGYKHSMATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSARSHYDHFLYIYTEK 277
            :||.|.:    |.|||.      ||||::...||..|.::.|..:...||:..:...|..::.|:
Mouse    46 VDDAGLL----SFATFS------WLTPVMIRSYKHTLTVDTLPPLSPYDSSDINAKRFQILWEEE 100

  Fly   278 KK-----KSNSSPSLWYCYIKNSWQMFALGGILKLAGDLFALIGP-LAIQKIVEYIEQLYAQASE 336
            .|     |::....:|. :.:....|..:..||.:   :.|.:|| :.|.:|:::|..:      
Mouse   101 IKRVGPEKASLGRVVWK-FQRTRVLMDVVANILCI---VMAALGPTVLIHQILQHITSI------ 155

  Fly   337 PPAKSPGNEVANVLLSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLLANGWCIAWIVLLAAITQG 401
                |.|:....:.|..: :..|||.:|.                    .|.:||.         
Mouse   156 ----SSGHIGIGICLCLA-LFTTEFTKVL--------------------FWALAWA--------- 186

  Fly   402 ALSQASTHILNMTGIRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQSTSSTSDEKQKNDDSMA 466
                    |...|.||:|.:|..||:...|                                |..
Mouse   187 --------INYRTAIRLKVALSTLIFENLL--------------------------------SFK 211

  Fly   467 TPEHVDNPSEPNISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLYMNLGISAVI 531
            |..|:          ..|.:.|.::.|:.::.|..|.......||..:.|.....:..||.:|::
Mouse   212 TLTHI----------SAGEVLNILSSDSYSLFEAALFCPLPATIPILMVVCAVYAFFILGSTALV 266

  Fly   532 GSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDERLKRIHDTLVGIKVIKLNAWDEVFLKKIQEAR 596
            | |:..:|..|:|.|:....|.........||:|::.:::.|..||:||:.||:|.|:..|.:.|
Mouse   267 G-ISVYLIFIPIQMFMAKLNSTFRRSAISVTDKRVQTMNEFLTCIKLIKMYAWEESFINTIHDIR 330

  Fly   597 RKELKYLNKDATFWTLMAVLTHIATVLITFVTLGVYVWLHRDQEFDLNASRLFSSLALFQQLTVP 661
            ::|.|.|.|.....:..:.|..|.:.:....|...:::|.|    .|.|...||.:|:|..:...
Mouse   331 KREKKLLEKAGYVQSGNSALAPIVSTIAIVSTFTCHIFLKR----KLTAPVAFSVIAMFNVMKFS 391

  Fly   662 LLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSDASLDMYETQEK------ 720
            :.|.|.:|..:..|.||.||:::.|                  ::||..|   |.||.:      
Mouse   392 IAILPFSVKAVAEASVSLRRMKKIL------------------IAKSPPS---YITQPEDPDTIL 435

  Fly   721 --SNMTMRTAQAENRLN-------EKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGH 776
              :|.|:...|..||.:       :||...|.|.|||         .:|:|..|           
Mouse   436 LLANATLTWEQEINRKSDPPKAQIQKRHVFKKQRPEL---------YSEQSRSD----------- 480

  Fly   777 NKLVQQRRELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSIND 841
                                                                            .
Mouse   481 ----------------------------------------------------------------Q 481

  Fly   842 GLFTWQPQSQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTI 906
            |:.:.:.||..|...||....:|.|||:..:.|..||||:||:||||.:|.|..|.:..:.  .:
Mouse   482 GVASPEWQSGSPKSVLHNISFVVRKGKVLGICGNVGSGKSSLISALLGQMQLQKGVVAVNG--PL 544

  Fly   907 SYVSQQPWLLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQR 971
            :|||||.|:.:..:||||||||.:..:||...:..|.|:.|:..:|.|||:.|||||:|:|||||
Mouse   545 AYVSQQAWIFHGNVRENILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQR 609

  Fly   972 QRIAIARAIYSSANVVIMDDPLASLDNEVGEHIFQHCIREMLQKSNRTFILVTQQLHRIKEAEYL 1036
            |||::|||:|::..:.::||||:::|..||:|:|:.||::.|:  .:|.:|||.||..::..:.:
Mouse   610 QRISLARAVYANRQLYLLDDPLSAVDAHVGKHVFEECIKKTLK--GKTVVLVTHQLQFLESCDEV 672

  Fly  1037 IAIKDGRVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNVSKLG 1101
            |.::||  |.|......|||:.|                            |...||:       
Mouse   673 ILLEDG--EICEKGTHKELMEER----------------------------GRYAKLI------- 700

  Fly  1102 LQRSISVTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRKRSSI 1166
                                                                             
Mouse   701 ----------------------------------------------------------------- 700

  Fly  1167 YGSRHLMYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSISGDV 1231
                                                       |.|.||                
Mouse   701 -------------------------------------------HNLRGL---------------- 706

  Fly  1232 LSRSVLATSCSSYAESSVDGGDLATAAPEPRVQSWQPPQHVTHHQPLSRNASSPPAMEVANPDVK 1296
                                             .::.|:|:               ..||..:..
Mouse   707 ---------------------------------QFKDPEHI---------------YNVAMVETL 723

  Fly  1297 KSEEARRSNTSSESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSISEESPPVVHF 1361
            |...|:|..                                        :::|:..:|.      
Mouse   724 KESPAQRDE----------------------------------------DAVLASGDEK------ 742

  Fly  1362 PASILATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSPADQEQHNERH 1426
                  .:|.:.||:.        .:|                        |::||        |
Mouse   743 ------DEGKEPETEE--------FVD------------------------TNAPA--------H 761

  Fly  1427 VLAEVAGESGRESMPLARLAIDTERKYGKISDDIYLMYIRAAG-----LPIITIFFI-----TAL 1481
            .|.:.  ||.:|               |.::...|..||:|:|     ..::.:||:     ...
Mouse   762 QLIQT--ESPQE---------------GIVTWKTYHTYIKASGGYLVSFLVLCLFFLMMGSSAFS 809

  Fly  1482 IWQCLRVYTDIWLQQWSNV-----HGRVASKGHVVLHPSEQDHEVTYYFRMYAAISCVCIIMALV 1541
            .|     :..|||.:.|.|     :.:.|......|    ||.:...|..:|.|.....::..::
Mouse   810 TW-----WLGIWLDRGSQVVCASQNNKTACNVDQTL----QDTKHHMYQLVYIASMVSVLMFGII 865

  Fly  1542 STPAGQYAGCNARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQRLLQF 1606
            ...........|..:||:::...|:...:.||..||.||::||||.||..:|.::....:..||.
Mouse   866 KGFTFTNTTLMASSSLHNRVFNKIVRSPMSFFDTTPTGRLMNRFSKDMDELDVRLPFHAENFLQQ 930

  Fly  1607 TLLCLSAILINVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVISHLSETIQGV 1671
            ..:.:..::|...:.|.:||:...:...:.::.:.:....:||:::||.:.||..||::.:|||:
Mouse   931 FFMVVFILVIMAAVFPVVLVVLAGLAVIFLILLRIFHRGVQELKQVENISRSPWFSHITSSIQGL 995

  Fly  1672 TTIRAFNQQTRFTEILFKRLEANTIAYAL-LNTSHRWLGVSLDYLGGCIVF-VATVTALTAASVS 1734
            ..|.|::::..... .||.|.....::.| .|.:.||..:.:|.|...:.| ||.:..|:.:|:|
Mouse   996 GVIHAYDKKDDCIS-KFKTLNDENSSHLLYFNCALRWFALRMDILMNIVTFVVALLVTLSFSSIS 1059

  Fly  1735 CRRHYEATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADMEM 1799
            .                                   |..||:::|.:.:...|...|:...:.:.
Mouse  1060 A-----------------------------------SSKGLSLSYIIQLSGLLQVCVRTGTETQA 1089

  Fly  1800 YAGSVERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGATT 1864
            ...|.|.:..|.                    |...|.                           
Mouse  1090 KFTSAELLREYI--------------------LTCVPE--------------------------- 1107

  Fly  1865 AAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHHPPATAGDK 1929
                                                                   |..|...|  
Mouse  1108 -------------------------------------------------------HTHPFKVG-- 1115

  Fly  1930 VEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYEGQ 1994
                                                     :.|..||.||:|.|.:..:||...
Mouse  1116 -----------------------------------------TCPKDWPSRGEITFKDYRMRYRDN 1139

  Fly  1995 KQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRTRL 2059
            ...|:..|.|.|.:||.:||.|||||||||||::||.:::...|.|.||:|||..:..::|||:|
Mouse  1140 TPLVLDGLNLNIQSGQTVGIVGRTGSGKSSLGMALFRLVEPASGTIIIDEVDICTVGLEDLRTKL 1204

  Fly  2060 SIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICDGGLNLSAGH 2124
            ::||||..||..|:|.||||.|...|..||:.||...:::.:. .||..|...:.:.|.|.|.|.
Mouse  1205 TMIPQDPVLFVGTVRYNLDPLGSHTDEMLWHVLERTFMRDTIM-KLPEKLQAEVTENGENFSVGE 1268

  Fly  2125 RQLLCLARAILRGSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITIAHRLTTILDYDRLIV 2189
            |||||:|||:||.|..::|||||:.:||.|::.:......||:..|::||||||.|:|:.|.::|
Mouse  1269 RQLLCMARALLRNSKIILLDEATASMDSKTDTLVQSTIKEAFKSCTVLTIAHRLNTVLNCDLVLV 1333

  Fly  2190 LDQGRIVEDGNPRELQQLEGSVFRGLL 2216
            ::.|:::|...|..|.:...|.|..||
Mouse  1334 MENGKVIEFDKPEVLAEKPDSAFAMLL 1360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
Abcc12NP_766500.3 CFTR_protein 44..1343 CDD:273530 436/2024 (22%)
ABC_membrane 127..388 CDD:294371 77/359 (21%)
ABCC_MRP_domain1 484..679 CDD:213217 85/201 (42%)
ABC_membrane 795..1077 CDD:294371 70/327 (21%)
ABCC_MRP_domain2 1125..1345 CDD:213211 96/221 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.