DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and Abcc4

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001028508.2 Gene:Abcc4 MGIID:2443111 Length:1325 Species:Mus musculus

Alignment Length:2016 Identity:455/2017 (23%)
Similarity:738/2017 (37%) Gaps:779/2017 (39%)


  Fly   226 ATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSARSHYDHFLYIYTEKK----KKSNSSPS 286
            |...|:..||||.||...|:|..||.:|:..:..||.:: |....|..|.:|:    ||.:..||
Mouse    16 ANLCSRVFFWWLNPLFKTGHKRRLEEDDMFSVLPEDRSK-HLGEELQRYWDKELLRAKKDSRKPS 79

  Fly   287 LWYCYIKNSWQMFALGGILKLAGDLFALIGPLAIQKIVEYIEQLYAQASEPPAKSPGNEVANVLL 351
            |....||..|:.:.:.||..|..:...::.||.:.||:||.|:.          .|.:.||    
Mouse    80 LTKAIIKCYWKSYLILGIFTLIEEGTRVVQPLFLGKIIEYFEKY----------DPDDSVA---- 130

  Fly   352 STSRILGTEFDEVFGTNIDKVRIYSSTWSDLLANGWCIAWIVLLAAITQGALSQASTHILNMTGI 416
                                           |...:..|.::.:..:....|.....:.:...|:
Mouse   131 -------------------------------LHTAYGYAAVLSMCTLILAILHHLYFYHVQCAGM 164

  Fly   417 RIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQSTSSTSDEKQKNDDSMATPEHVDNPSEPNISH 481
            |::.::..:||||:|.|       |:.:.|:..:                               
Mouse   165 RLRVAMCHMIYRKALRL-------SNSAMGKTTT------------------------------- 191

  Fly   482 DIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLYMNLGISAVIGSIACIVIMTPLQFF 546
              |.|.|.::.|.....:..:.:|:.||.|.:...|..||::.:|||.:.| :|.:||:.|||..
Mouse   192 --GQIVNLLSNDVNKFDQVTIFLHFLWAGPLQAIAVTVLLWVEIGISCLAG-LAVLVILLPLQSC 253

  Fly   547 IGNAMSKNAEVIAGYTDERLKRIHDTLVGIKVIKLNAWDEVFLKKIQEARRKEL------KYLN- 604
            ||...|......|.:||.|::.:::.:.|:::||:.||::.|...|...|:||:      .||. 
Mouse   254 IGKLFSSLRSKTAAFTDARIRTMNEVITGMRIIKMYAWEKSFADLIANLRKKEISKILGSSYLRG 318

  Fly   605 -KDATFWTLMAVLTHIATVLITFVTLGVYVWLHRDQEFDLNASRLFSSLALF--QQLTVPLLIFP 666
             ..|:|:        ||..:|.|||...||.|..    ::.||.:|.::.|:  .:||| .|.||
Mouse   319 MNMASFF--------IANKVILFVTFTSYVLLGN----EITASHVFVAMTLYGAVRLTV-TLFFP 370

  Fly   667 ITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSDASLDMYETQEKSNMTMRTAQAE 731
            ..:.....|.||.||::.||...|:                         .|.|:::        
Mouse   371 SAIERGSEAIVSIRRIKNFLLLDEL-------------------------PQRKAHV-------- 402

  Fly   732 NRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGHNKLVQQRRELLRNTPYVAIR 796
                                                ||..:.:.|                    
Mouse   403 ------------------------------------PSDGKAIVH-------------------- 411

  Fly   797 PPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSINDGLFTWQPQSQMPVVQLHVPG 861
                                                      :.|....|......|.:|    |
Mouse   412 ------------------------------------------VQDFTAFWDKALDSPTLQ----G 430

  Fly   862 I--IVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTISYVSQQPWLLNDTIRENI 924
            :  |...|:|..|||..|:||:|||||:|.|:|..:|.:..|.  .|:|||||||:.:.|:|.||
Mouse   431 LSFIARPGELLAVVGPVGAGKSSLLSAVLGELPPASGLVSVHG--RIAYVSQQPWVFSGTVRSNI 493

  Fly   925 LFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRIAIARAIYSSANVVIM 989
            |||:.:..:||:.|::|||||.|::|:..|||::||:||..:||||:.|:.:|||:|..|::.::
Mouse   494 LFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGATLSGGQKARVNLARAVYQDADIYLL 558

  Fly   990 DDPLASLDNEVGEHIFQHCIREMLQKSNRTFILVTQQLHRIKEAEYLIAIKDGRVEACGSYADIE 1054
            ||||:::|.|||:|:||.||.:.|.:  :..||||.||..:|.|.:::.:|||.:...|:|.  |
Mouse   559 DDPLSAVDAEVGKHLFQLCICQALHE--KITILVTHQLQYLKAASHILILKDGEMVQKGTYT--E 619

  Fly  1055 LMQPRITAEWNAIIAMAKAKND--NPSQNPGEKTAGERWKLLKNVSKLGLQRSISVTMDANVACH 1117
            .::..:  ::.:::   |.:|:  .||..||..|.                              
Mouse   620 FLKSGV--DFGSLL---KKENEEAEPSTAPGTPTL------------------------------ 649

  Fly  1118 ADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRKRSSIYGSRHLMYDVPLPIDE 1182
                                                       |||                   
Mouse   650 -------------------------------------------RKR------------------- 652

  Fly  1183 CQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSISGDVLSRSVLATSCSSYAES 1247
                                                                        :::|:
Mouse   653 ------------------------------------------------------------TFSEA 657

  Fly  1248 SVDGGDLATAAPEPRVQSWQPPQHVTHHQPLSRNASSPPAMEVANPDVKKSEEARRSNTSSESPL 1312
            |:                |.             ..||.|:::...|:.:.:|     ||.:..| 
Mouse   658 SI----------------WS-------------QQSSRPSLKDGAPEGQDAE-----NTQAVQP- 687

  Fly  1313 DDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSISEESPPVVHFPASILATDGNKNETQS 1377
                                                    |||                      
Mouse   688 ----------------------------------------EES---------------------- 690

  Fly  1378 EEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSPADQEQHNERHVLAEVAGESGRESMPL 1442
                                                                             
Mouse   691 ----------------------------------------------------------------- 690

  Fly  1443 ARLAIDTERKYGKISDDIYLMYIRAAGLPIITIFFITA-LIWQCLRVYTDIWLQQWSNVHGRV-- 1504
                    |..|:|....|..|..|.......||.:.. ::.|...|..|.||..|:|..|.:  
Mouse   691 --------RSEGRIGFKAYKNYFSAGASWFFIIFLVLLNMVGQVFYVLQDWWLSHWANKQGALNN 747

  Fly  1505 --ASKGHVVLHPSEQDHEVTYYFRMYAAISCVCIIMALVSTPAGQYAGCNARRNLHDKLLQTILH 1567
              .:.|::.     :..::::|..:||.::.|.::..:..:....|...||.:.||:::.::||.
Mouse   748 TRNANGNIT-----ETLDLSWYLGIYAGLTAVTVLFGIARSLLVFYILVNASQTLHNRMFESILK 807

  Fly  1568 KTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQRLLQFTLLCLSAILINVTITPWILVLTLPIC 1632
            ..:.||...|:|||:||||.|:..:|..:..|....:|..||.:|.|.:...:.||||:..:|:.
Mouse   808 APVLFFDRNPIGRILNRFSKDIGHMDDLLPLTFLDFIQTLLLVVSVIAVAAAVIPWILIPLVPLS 872

  Fly  1633 GAYYLIQKFYRCSARELQRIENATNSPVISHLSETIQGVTTIRAFNQQTRFTEILFKRLEANTIA 1697
            ..:.::::::..::|:::|:|:.|.|||.||||.::||:.||||:..:.|..|:.....:.::.|
Mouse   873 VVFLVLRRYFLETSRDVKRLESTTRSPVFSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEA 937

  Fly  1698 YALLNTSHRWLGVSLDYLGGCIVFVATVTALTAASVSCRRHYEATTSPSASASPSPFETYAVTKS 1762
            :.|..|:.||..|.||.:  |.:||..|.                           |.:..:.|:
Mouse   938 WFLFLTTSRWFAVRLDAI--CAIFVIVVA---------------------------FGSLVLAKT 973

  Fly  1763 PSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADMEMYAGSVERIAHYAQGQDADADADADADAD 1827
                 .:...||||::|.|.:.....|.|:..|::|....||||:..|                 
Mouse   974 -----LNAGQVGLALSYALTLMGMFQWSVRQSAEVENMMISVERVIEY----------------- 1016

  Fly  1828 VDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGATTAAGDVDEDGDQQRIGGARGGGGDCGYRQ 1892
              .||:.|                                                ...:|    
Mouse  1017 --TDLEKE------------------------------------------------APWEC---- 1027

  Fly  1893 GHENGAEANADKLNAGNVTGDGNHLNFHHPPATAGDKVEQATTKTSVIKDKQLPPQQDDKDKKVV 1957
                                                              |:.||.         
Mouse  1028 --------------------------------------------------KKRPPP--------- 1033

  Fly  1958 LPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGK 2022
                             .||..|.|.||||:..|......|:.:||..|.:.:::||.||||:||
Mouse  1034 -----------------GWPHEGVIVFDNVNFTYSLDGPLVLKHLTALIKSREKVGIVGRTGAGK 1081

  Fly  2023 SSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRTRLSIIPQDVHLFNATIRENLDPHGYFQDLQ 2087
            |||..:||. |....|.|:||.:....|...:||.::|||||:..||..|:|:||||.....|.:
Mouse  1082 SSLISALFR-LSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEE 1145

  Fly  2088 LWNCLELAQLKEFVNGHLPLGLDTVICDGGLNLSAGHRQLLCLARAILRGSVCLVLDEATSVLDS 2152
            ||..||..||||.:. .||..:||.:.:.|.|.|.|.|||:|||||||:.:..|::||||:.:|.
Mouse  1146 LWRALEEVQLKEAIE-DLPGKMDTELAESGSNFSVGQRQLVCLARAILKNNRILIIDEATANVDP 1209

  Fly  2153 STESALLKAADLAFRGRTIITIAHRLTTILDYDRLIVLDQGRIVEDGNPRELQQLEGSVFRGLLE 2217
            .|:..:.:.....|...|::||||||.||:|.|:::|||.||:.|...|..|.|...|:|..:::
Mouse  1210 RTDELIQQKIREKFAQCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNPESLFYKMVQ 1274

  Fly  2218 K 2218
            :
Mouse  1275 Q 1275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
Abcc4NP_001028508.2 CFTR_protein 11..1269 CDD:273530 454/2009 (23%)
ABC_membrane 96..365 CDD:294371 83/367 (23%)
ABCC_MRP_domain1 410..610 CDD:213217 92/270 (34%)
ABC_membrane 718..991 CDD:279056 82/312 (26%)
ABCC_MRP_domain2 1039..1258 CDD:213211 97/221 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.