DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and mrp-1

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001024719.2 Gene:mrp-1 WormBaseID:WBGene00003407 Length:1534 Species:Caenorhabditis elegans

Alignment Length:2234 Identity:518/2235 (23%)
Similarity:815/2235 (36%) Gaps:810/2235 (36%)


  Fly    39 TFFSIFLLLFGLMFVCSRYKKCHKTLLTFHNGRAAISLLLL--ALNSFDLARIFLPHQNVRNLNR 101
            |..::||::|..:.....||..:..|.:|    :||||.::  .|...||....     :.:...
 Worm    41 TIPTLFLVIFSPILFYELYKSRNSYLRSF----SAISLRIIFCCLLVVDLTATV-----IYDFYL 96

  Fly   102 LFQSSPRDLNYLVVIGSGELWNAL-----------FSTLLTLMLMLYHR-MVERKKATVF--LYA 152
            ||..||             |:||:           |...|.|.:...:| ::.....|::  |..
 Worm    97 LFTKSP-------------LYNAIHFYGDLVQYAGFCLALVLTIACRNRGIITSGVITLYWLLVV 148

  Fly   153 STAVEALTFALLSNELFELVRYEDFLELQTCLVAMSAMCMVSLAMLDGLTVYKECYHDDYLDDY- 216
            ...|..|.:.:...      .|::: |:.:|..|:.....|..|    |.::..|:.|...:.| 
 Worm   149 VCGVPELRYYITGR------LYKEY-EIHSCRAALYVFAYVCSA----LELFLSCFADTPSNGYI 202

  Fly   217 GKIGYKHSMATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSARSHYDHFLYI-------Y 274
            ||.......|:|.::..|.|.:.|.:||.|:.||.|||..:...|.|.:....|:..       |
 Worm   203 GKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGY 267

  Fly   275 TEKKKKS------NSSPSLWYCYIKNSWQMFALGGILKLAGDLFALIGPLAIQKIVEYIEQLYAQ 333
            ..|.||:      .:.||:.....|........||..||..||...:.|..:::::.:||    .
 Worm   268 RRKIKKNPEAAIPKNHPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIE----D 328

  Fly   334 ASEPPAKSPGNEVANVLLSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLLANGWCIAWIVLLAAI 398
            .::|                                        .|.     |..||.::.|:::
 Worm   329 KNQP----------------------------------------MWI-----GVSIALLMFLSSL 348

  Fly   399 TQGALSQASTHILNMTGIRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQSTSSTSDEKQKNDD 463
            .|..:.....|.:...|:.|::.|...:|.|:|.|                     |:|.:|...
 Worm   349 LQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNL---------------------SNEARKGKT 392

  Fly   464 SMATPEHVDNPSEPNISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLYMNLGIS 528
            :                   |:|.|.|:.|.:.|.:....|...|:.|.:|.:.:|.|:..||:|
 Worm   393 T-------------------GAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVS 438

  Fly   529 AVIGSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDERLKRIHDTLVGIKVIKLNAWDEVFLKKIQ 593
            .:.|.: .::::.|...||...|.........:.|||:|.:.:.|.|:||:||.:|::...|.:.
 Worm   439 VLAGFV-ILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVL 502

  Fly   594 EARRKE------LKYLNKDATF-WTLMAVLTHIATVLITFVTLGVYV-WLHRDQEFDLNASRL-F 649
            |.|.||      |.|||...|. |.       .|..|:..:|.|:|| |   |.|.::...:: |
 Worm   503 EVREKEIRVLKKLSYLNAATTLSWA-------CAPFLVAVLTFGLYVLW---DPENNVLTPQITF 557

  Fly   650 SSLALFQQLTVPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSDASLDM 714
            .:||||..|..||.:|.:.....:....|..||:.|.                            
 Worm   558 VALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFF---------------------------- 594

  Fly   715 YETQEKSNMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGHNKL 779
                                                           :||::||.|....|    
 Worm   595 -----------------------------------------------AAEEMSPQTSIAYG---- 608

  Fly   780 VQQRRELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSINDGLF 844
                                                  .|||              |:.::.|.|
 Worm   609 --------------------------------------GTDS--------------AIKMDGGSF 621

  Fly   845 TWQPQSQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTISYV 909
            .|..:.:..  :||.....:.:|:|..:||:.||||:|||.|||.||..|:|::  ....:::||
 Worm   622 AWGSKEEDR--KLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSV--QVNGSVAYV 682

  Fly   910 SQQPWLLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRI 974
            .|..|:.|.::|.||||...:..|.|..|:|.|||..|:|.:|..|.:.|||:|||:||||:||:
 Worm   683 PQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRV 747

  Fly   975 AIARAIYSSANVVIMDDPLASLDNEVGEHIFQH-------CIREMLQKSNRTFILVTQQLHRIKE 1032
            ::|||:|.:|.:|::||||:::|:.||:|||::       |:      ..:|.:|:|..|..:|.
 Worm   748 SLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCL------GTKTRVLLTHGLTYLKH 806

  Fly  1033 AEYLIAIKDGRVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNV 1097
            .:.:|.:||..:...|:|.::                                            
 Worm   807 CDQVIVLKDETISEMGTYQEL-------------------------------------------- 827

  Fly  1098 SKLGLQRSISVTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRK 1162
                        |::|.|.                 |..:||                 |.|:  
 Worm   828 ------------MNSNGAF-----------------SEFLEE-----------------FLLE-- 844

  Fly  1163 RSSIYGSRHLMYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSI 1227
                                                        .|.|:                
 Worm   845 --------------------------------------------ESKHK---------------- 849

  Fly  1228 SGDVLSRSVLATSCSSYAESSVDGGDL------ATAAPEPRVQSWQPPQHVTHHQPLSRNASSPP 1286
                 .|||      |:.|.|.:..:|      .:.|...|:||..                   
 Worm   850 -----GRSV------SFGEDSKEVNELLRDLDQVSPAIRQRIQSQM------------------- 884

  Fly  1287 AMEVANPDVKKSEEARRSNTSSESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSI 1351
            :.|:...|.|.:|..|..                                .|....:|.:||   
 Worm   885 SQEIEKTDDKNAEIIRNG--------------------------------LHKDEQTAHSSI--- 914

  Fly  1352 SEESPPVVHFPASILATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSP 1416
                                   .:||||......|..||.|                      |
 Worm   915 -----------------------GKSEEKESLLGAISPKEKT----------------------P 934

  Fly  1417 ADQEQHNERHVLAEVAGESGRESMPLARLAIDTERKYGKISDDIYLMYIRAAGLPIITIFFITAL 1481
            ...:|...:.:..|               |::|    ||:..::|:.|.||.|:.|..:||:..:
 Worm   935 EPPKQTKTQLIEKE---------------AVET----GKVKFEVYMSYFRAIGIKIALVFFLVYV 980

  Fly  1482 IWQCLRVYTDIWLQQWSNVHGRVASKGHVVLHPSEQDHEVTYYFRMYAAI-----SCVC---IIM 1538
            ....|.|:::::|.:||:....:|..|      :....|......:||.:     :.||   |||
 Worm   981 ASSMLGVFSNLYLARWSDDAKEIALSG------NGSSSETQIRLGIYAVLGMGQATSVCAASIIM 1039

  Fly  1539 ALVSTPAGQYAGCNARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQRL 1603
            ||...       | |.|.||..||:.|:...:.||.|||||||:|||..|:..:|..|..|....
 Worm  1040 ALGMV-------C-ASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDVDGVDTDIPRTMSMF 1096

  Fly  1604 LQFTLLCLSAILINVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVISHLSETI 1668
            ::..:..:..|.|.:..||..:.|.||:...|:::.:||..::|:|:|:|:|:.||:.||..|:|
 Worm  1097 IRTAVSSIEIIAIILWATPLAISLLLPLFIVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESI 1161

  Fly  1669 QGVTTIRAFNQQTRFTEILFKRLEANTIAYALLNTSHRWLGVSLDYLGGCIVFVATVTALTAASV 1733
            ||.::|||:....:|......|::.|...|.....::|||.|.|:.:|..||.     :...|:|
 Worm  1162 QGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVL-----SSAGAAV 1221

  Fly  1734 SCRRHYEATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADME 1798
            ..|      .||..||                     .||||:::|.|.:...|||.|::.:::|
 Worm  1222 YFR------DSPGLSA---------------------GLVGLSVSYALNITQTLNWAVRMTSELE 1259

  Fly  1799 MYAGSVERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGAT 1863
            ....:||||..|.                              ::.....:|||.|         
 Worm  1260 TNIVAVERINEYT------------------------------ITPTEGNNSQSLA--------- 1285

  Fly  1864 TAAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHHPPATAGD 1928
                                                                             
 Worm  1286 ----------------------------------------------------------------- 1285

  Fly  1929 KVEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYEG 1993
                                                        |.|||:.|:|...|.|:||..
 Worm  1286 --------------------------------------------PKSWPENGEISIKNFSVRYRP 1306

  Fly  1994 QKQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRTR 2058
            ....|:..:|..|...::|||.||||:|||||.|:||.:::...|.|.||..:|..:..::||:|
 Worm  1307 GLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSR 1371

  Fly  2059 LSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICDGGLNLSAG 2123
            |:|:|||..||:.|:|.||||...|.|.|:|..|..|.|..||.. |..||...|.:||.|||.|
 Worm  1372 LTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKS-LQEGLHHHISEGGENLSVG 1435

  Fly  2124 HRQLLCLARAILRGSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITIAHRLTTILDYDRLI 2188
            .|||:|||||:||.:..||||||.:.:|..|:|.|.|.....|:..|::||||||.|::|.|||:
 Worm  1436 QRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLL 1500

  Fly  2189 VLDQGRIVEDGNPRELQQLEGSVF 2212
            |||:|.:.|...|::|......:|
 Worm  1501 VLDKGCVAEFDTPKKLLSNPDGIF 1524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
mrp-1NP_001024719.2 MRP_assoc_pro 23..1531 CDD:188098 518/2235 (23%)
ABC_membrane 309..570 CDD:294371 81/361 (22%)
ABCC_MRP_domain1 614..815 CDD:213217 80/211 (38%)
ABC_membrane 976..1248 CDD:279056 93/318 (29%)
ABCC_MRP_domain2 1293..1513 CDD:213211 103/221 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.