DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and Abcc5

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:XP_006248655.1 Gene:Abcc5 RGDID:70913 Length:1437 Species:Rattus norvegicus

Alignment Length:2077 Identity:467/2078 (22%)
Similarity:774/2078 (37%) Gaps:728/2078 (35%)


  Fly   183 CLVAMSAMCMVSLAMLDGLTVYKECYHDDYLD-DYGKIGYKHSM------------------ATF 228
            |..|:.....|....|| ::|:.   |...|| ::.|..|.|.:                  |..
  Rat    47 CQDALETAARVEGLSLD-ISVHS---HLQILDEEHTKGKYHHGLSALKPFRTTTKHQHPVDNAGL 107

  Fly   229 YSKSCFWWLTPLLWLGYKE-PLELEDLGQMKLEDSARSHYDHFLYIYTEKKKKSNSSPS-----L 287
            :|...|.||:||..:.:|: .|.:||:..:...:|:..:......::.|:..:.....:     :
  Rat   108 FSYMTFSWLSPLAQVVHKKGELLMEDVWPLSKYESSDVNCRRLERLWQEELNEVGPDAASLRRVV 172

  Fly   288 W-YCYIKNSWQMFALGGILKLAGDLFALIGP-LAIQKIVEYIEQLYAQASEPPAKSPGNEVANVL 350
            | :|..:....:..| .|.:|||    ..|| ..::.::|     |.||:|          :|:.
  Rat   173 WIFCRTRLILSIVCL-MITQLAG----FSGPAFVVKHLLE-----YTQATE----------SNLQ 217

  Fly   351 LSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLLANGWCIAWIVLLAAITQGALSQASTHILNMTG 415
            .|...:||....||       ||    :||  ||..|.:.:                     .||
  Rat   218 YSLLLVLGLLLTEV-------VR----SWS--LALTWALNY---------------------RTG 248

  Fly   416 IRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQSTSSTSDEKQKNDDSMATPEHVDNPSEPNIS 480
            :|::.::..:.::|.|.|                     .:.|:|:                   
  Rat   249 VRLRGAVLTMAFKKILKL---------------------KNIKEKS------------------- 273

  Fly   481 HDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKIAVVIYLLY--MNLGISAVIGSIACIVIMTPL 543
              :|.:.|..:.|.:.:.|...:.......|  :..::.::|  :.||.:..:|| |..::..|.
  Rat   274 --LGELINICSNDGQRMFEAAAVGSLLAGGP--VVAILGMIYNVIILGPTGFLGS-AVFILFYPA 333

  Fly   544 QFFIGNAMSKNAEVIAGYTDERLKRIHDTLVGIKVIKLNAWDEVFLKKIQEARRKELKYLNKDAT 608
            ..|:....:.........||:|::::::.|..||.||:.||.:.|.:.:|:.|.:|.:.|.|...
  Rat   334 MMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGY 398

  Fly   609 FWTLMAVLTHIATVLITFVTLGVYVWLHRDQEFDLNASRLFSSLALFQQLTVPLLIFPITVPIII 673
            |.::...:..|..|:.:.||..|::.|    .|||.|::.|:.:.:|..:|..|.:.|.:|..:.
  Rat   399 FQSITVGVAPIVVVIASVVTFSVHMTL----GFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLS 459

  Fly   674 AARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSDASLDMYETQEKSNMTMRTAQAENRLNEKR 738
            .|.|:   ::|| ||..:.::...|:|..   :.....::|.......:.:..:.|:..:|..| 
  Rat   460 EASVA---VDRF-KSLFLMEEVHMIKNKP---ASPHIKIEMKNATLAWDSSHSSTQSSPKLTPK- 516

  Fly   739 LAQKSQTPELATNSTPLLQNAEESAEDISPSTVQELGHNKLVQQRRELLRNTPYVAIRPPKMRGS 803
            :.:..:.|:.....:..||:.|..|              .|.:|:..||.::.            
  Rat   517 VKKDKRAPKGKKEKSRQLQHTEHQA--------------VLAEQKGHLLLDSD------------ 555

  Fly   804 VMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSINDGLFTWQPQSQMPVVQLHVPGIIVPKGK 868
              |||                     ...::....|:.|....|.       .|:...:.:.:||
  Rat   556 --ERP---------------------SPEEEEGKQIHAGSMRLQR-------TLYNIDLEIEEGK 590

  Fly   869 LTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTCTISYVSQQPWLLNDTIRENILFGESFRPK 933
            |..:.|..|||||||:||:|.:|.||.|::  ..:.|.:||:||.|:||.|:|:|||||:.|..:
  Rat   591 LVGICGSVGSGKTSLISAILGQMTLLEGSI--AVSGTFAYVAQQAWILNATLRDNILFGKEFDEE 653

  Fly   934 RYDFVLEACALKPDIELMPRGDLSIIGERGINISGGQRQRIAIARAIYSSANVVIMDDPLASLDN 998
            ||:.||.:|.|:||:.::|..||:.|||||.|:||||||||::|||:||..::.|:||||::||.
  Rat   654 RYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDA 718

  Fly   999 EVGEHIFQHCIREMLQKSNRTFILVTQQLHRIKEAEYLIAIKDGRVEACGSYADIELMQPRITAE 1063
            .||.|||...||:.|:  ::|.:.||.||..:.:.:.:|.:|:|.:...|::.  |||       
  Rat   719 HVGNHIFNSAIRKRLK--SKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHE--ELM------- 772

  Fly  1064 WNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNVSKLGLQRSISVTMDANVACHADAIDGSGCIS 1128
                                                                             
  Rat   773 ----------------------------------------------------------------- 772

  Fly  1129 VANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRKRSSIYGSRHLMYDVPLPIDECQGDDVIMRPR 1193
                                         ||....::|:.:. |:.:.| |::            
  Rat   773 -----------------------------NLNGDYATIFNNL-LLGETP-PVE------------ 794

  Fly  1194 RRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSISGDVLSRSVLATSCSSYAESSVDGGDLATAA 1258
                        .||....||                              ::.|.|.|      
  Rat   795 ------------INSKKEASG------------------------------SQKSQDKG------ 811

  Fly  1259 PEPRVQSWQPPQHVTHHQPLSRNASSPPAMEVANPDVKKSEEARRSNTSSESPLDDHVRGSFQQF 1323
            |:|                               ..|||.:..:                     
  Rat   812 PKP-------------------------------GSVKKEKAVK--------------------- 824

  Fly  1324 LRRMSMRRSNKPKNHHHPLSATNSILSISEESPPVVHFPASILATDGNKNETQSEEKPKKCVNID 1388
                                        |||...|                 |.|||        
  Rat   825 ----------------------------SEEGQLV-----------------QVEEK-------- 836

  Fly  1389 SKETTINCDDNCYSASDKELRANVTSSPADQEQHNERHVLAEVAGESGRESMPLARLAIDTERKY 1453
                                                           |:.|:|.:          
  Rat   837 -----------------------------------------------GQGSVPWS---------- 844

  Fly  1454 GKISDDIYLMYIRAAGLPIITIFFITALIWQCLRV----YTDIWLQQW---SNVHGRVASKGHVV 1511
                  :|.:||:|||.|:.   |:..::...|.|    ::..||..|   .:.:..|.......
  Rat   845 ------VYWVYIQAAGGPLA---FLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVFEGNRSS 900

  Fly  1512 LHPSEQDHE-VTYYFRMYAAISCVCIIMALVSTPAGQYAGCNARRNLHDKLLQTILHKTLHFFQV 1575
            :..|.:|:. :.||..:||....|.:|:..:...........|...|||:|.:.||...:.||..
  Rat   901 VSDSMRDNPFLQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDT 965

  Fly  1576 TPLGRIVNRFSNDMAVIDKKIAATGQRLLQFTLLCLSAILINVTITPWILVLTLPICGAYYLIQK 1640
            ||.|||:||||.||..:|.::....:..:|..:|....:.:...:.||.||...|:...:.::..
  Rat   966 TPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSVLHI 1030

  Fly  1641 FYRCSARELQRIENATNSPVISHLSETIQGVTTIRAFNQQTRFTEILFKRLEANTIAYALLNTSH 1705
            ..|...|||:|::|.|.||.:||::.:|||:.||.|:|::..|.....:.|:.|...:.|...:.
  Rat  1031 VSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELLDDNQAPFFLFTCAM 1095

  Fly  1706 RWLGVSLDYLGGCIVFVATVTALTAASVSCRRHYEATTSPSASASPSPFETYAVTKSPSELRPSP 1770
            |||.|.||     ::.:|.:|  |...:....|.:.   |||.|                     
  Rat  1096 RWLAVRLD-----LISIALIT--TTGLMIVLMHGQI---PSAYA--------------------- 1129

  Fly  1771 SLVGLAINYTLLVPIYLNWVVKLLADMEMYAGSVERIAHYAQGQDADADADADADADVDADLDHE 1835
               ||||:|.:.:.....:.|:|.::.|....|||||.||.:....:|.|.              
  Rat  1130 ---GLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPAR-------------- 1177

  Fly  1836 PSSNEDVSAEVDRSSQSDAGDKVYPGATTAAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEA 1900
                                                                             
  Rat  1178 ----------------------------------------------------------------- 1177

  Fly  1901 NADKLNAGNVTGDGNHLNFHHPPATAGDKVEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARK 1965
                                                   ||:| .||.                 
  Rat  1178 ---------------------------------------IKNK-APPH----------------- 1185

  Fly  1966 LERYQSVPISWPQRGDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLF 2030
                     .|||.|:|.|:|..:||......|:..::..|...::|||.|||||||||||::||
  Rat  1186 ---------DWPQEGEITFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALF 1241

  Fly  2031 GVLQTTRGHIYIDDVDIQRIRPDELRTRLSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELA 2095
            .:::.:.|.|.||.|.|..|...:||::|:||||:..||:.|:|.||||...:.:.|:|:.||..
  Rat  1242 RLVELSGGCIKIDGVRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEEQIWDALERT 1306

  Fly  2096 QLKEFVNGHLPLGLDTVICDGGLNLSAGHRQLLCLARAILRGSVCLVLDEATSVLDSSTESALLK 2160
            .:||.: ..|||.|::.:.:.|.|.|.|.|||||:|||:||....|:|||||:.:|:.|:..:.:
  Rat  1307 HMKECI-AQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQE 1370

  Fly  2161 AADLAFRGRTIITIAHRLTTILDYDRLIVLDQGRIVEDGNPRELQQLEGSVFRGLLEKGASK 2222
            ....||...|::||||||.|:|..||::||.||::||...|..|...:.|.|..:.....:|
  Rat  1371 TIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMCAAAENK 1432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
Abcc5XP_006248655.1 CFTR_protein 101..1430 CDD:273530 454/2016 (23%)
ABC_membrane <272..448 CDD:294371 44/204 (22%)
ABCC_MRP_domain1 578..760 CDD:213217 87/186 (47%)
ABC_membrane 863..1143 CDD:294371 83/314 (26%)
ABCC_MRP_domain2 1191..1411 CDD:213211 97/221 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.