DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and ABCC9

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_005682.2 Gene:ABCC9 HGNCID:60 Length:1549 Species:Homo sapiens

Alignment Length:2246 Identity:561/2247 (25%)
Similarity:867/2247 (39%) Gaps:775/2247 (34%)


  Fly    19 SIYDNLNTDICGIDR---VRRVFTFFSIFLLLF-GLMFVCSRYKKCHKTLLTF--HNGRAAISLL 77
            :|.|.:..:.|.:|.   |..||..|..|.:|| |.....|:.:..|.|.|.|  ||.|..::..
Human    14 NINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHHNTWLHFPGHNLRWILTFA 78

  Fly    78 LLALNSFDLARIFLPHQNVRNLNRLFQSSPRDLNYLVVIGSGELWNALFSTLLTLMLMLYHRMVE 142
            ||.::..::|            ..:...|.|:..:|.:     ...|:...:.|...::|:..:|
Human    79 LLFVHVCEIA------------EGIVSDSRRESRHLHL-----FMPAVMGFVATTTSIVYYHNIE 126

  Fly   143 RKKATVFLYASTAVEALTFALLSNELFELVRY----EDFLELQTCLVAMSAMCMVSLAMLDGLTV 203
            .......|.|......:.|.   .:..:||:|    .|...|:.|:..|       :.:|:||.:
Human   127 TSNFPKLLLALFLYWVMAFI---TKTIKLVKYCQSGLDISNLRFCITGM-------MVILNGLLM 181

  Fly   204 YKE-----------------CYHDDYLDDYGKIGYKHSMATFYSKSCFWWLTPLLWLGYKEPLEL 251
            ..|                 ....:.|.|.| :.:........||:.:||:..|:...:|:|::|
Human   182 AVEINVIRVRRYVFFMNPQKVKPPEDLQDLG-VRFLQPFVNLLSKATYWWMNTLIISAHKKPIDL 245

  Fly   252 EDLGQMKLEDSARSHYDHFLYIYTEKKKK----SNSSPSLWYCYIKNSWQMFALGGILKLAGDLF 312
            :.:|::.:...|.::|......|.|:|||    .|.:||:|....:...:...|....:...||.
Human   246 KAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLSSTFRYLADLL 310

  Fly   313 ALIGPLAIQKIVEYIEQLYAQASEPPAKSPGNEVANVLLSTSRILGTEFDEVFGTNIDKVRIYSS 377
            ...|||.|..||:.:                ||..|...:|:.|                   |.
Human   311 GFAGPLCISGIVQRV----------------NETQNGTNNTTGI-------------------SE 340

  Fly   378 TWS--DLLANGWCIAWIVLLAAITQGALSQASTHILNMTGIRIKTSLQGLIYRKSLLLNADGGCD 440
            |.|  :.|.|.:.:|.::.||.|.|....|||.::...|||.::.:|..:||.|.|.|:.     
Human   341 TLSSKEFLENAYVLAVLLFLALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLST----- 400

  Fly   441 SSDSAGQVQSTSSTSDEKQKNDDSMATPEHVDNPSEPNISHDIGSITNHMTEDTRNIMEFFLIIH 505
            |:.|.|::                                 .:|.|.|.:..:|..:|.|..:..
Human   401 SNLSMGEM---------------------------------TLGQINNLVAIETNQLMWFLFLCP 432

  Fly   506 YAWAIPFKIAVVIYLLYMNLGISAVIGSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDERLKRIH 570
            ..||:|.:|.:.:.|||..||.||::|: |.||::.|:|:||...:::..:....|:.||||:.:
Human   433 NLWAMPVQIIMGVILLYNLLGSSALVGA-AVIVLLAPIQYFIATKLAEAQKSTLDYSTERLKKTN 496

  Fly   571 DTLVGIKVIKLNAWDEVFLKKIQEARRKELKYLNKDATFWTL---MAVLTHIATVLITFVTLGVY 632
            :.|.|||::||.||:.:|.|.::|.|.|||..|...|.:.:|   |.....||.||.||||   :
Human   497 EILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSIFMNAAIPIAAVLATFVT---H 558

  Fly   633 VWLHRDQEFDLNASRLFSSLALFQQLTVPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEG 697
            .:...:   :|..:..|:||:||..|..||.:....|...:.|.:|.::|..||.|.||..    
Human   559 AYASGN---NLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAIISVQKLNEFLLSDEIGD---- 616

  Fly   698 IRNMARILSKSDASLDMYETQEKSNMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNAEES 762
                           |.:.|.| |::...:.:....:..|.:.:|              |.....
Human   617 ---------------DSWRTGE-SSLPFESCKKHTGVQPKTINRK--------------QPGRYH 651

  Fly   763 AEDISPSTVQELGHNKLVQQRRELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSL 827
            .:....||             |.|                    ||.|                 
Human   652 LDSYEQST-------------RRL--------------------RPAE----------------- 666

  Fly   828 LLKMPDDIAVSINDGLFTWQPQSQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMP 892
                .:|||:.:.:|.|:|    ...:..|....|.:|.|:||::||:.|.||:|||.|:|.||.
Human   667 ----TEDIAIKVTNGYFSW----GSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQ 723

  Fly   893 LLAGNMFW---------------HKTCTISYVSQQPWLLNDTIRENILFGESFRPKRYDFVLEAC 942
            .|.|.:.|               ....:::|.:|:|||||.|:.|||.||..|..:||..|.:||
Human   724 TLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQRYKAVTDAC 788

  Fly   943 ALKPDIELMPRGDLSIIGERGINISGGQRQRIAIARAIYSSANVVIMDDPLASLDNEVGEHIFQH 1007
            :|:|||:|:|.||.:.|||||||:||||||||.:|||:|.:.|:|.:|||.::||..:.:|:.|.
Human   789 SLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSDHLMQE 853

  Fly  1008 CIREMLQKSNRTFILVTQQLHRIKEAEYLIAIKDGRVEACGSYADIELMQPRITAEWNAIIAMAK 1072
            .|.:.||...||.:|||.:|..:..|:::||:|||.|...|:..||:.....:.           
Human   854 GILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQTKDVELY----------- 907

  Fly  1073 AKNDNPSQNPGEKTAGERWKLLKNVSKLGLQRSISVTMDANVACHADAIDGSGCISVANMQSNVV 1137
                            |.||.|.|.....|::.:                               
Human   908 ----------------EHWKTLMNRQDQELEKDM------------------------------- 925

  Fly  1138 EEDDQVSVSYPIGNASCGGFNLQRKRSSIYGSRHLMYDVPLPIDECQGDDVIMRPRRRHTLGRRG 1202
             |.||.:              |:||.     .|..||                            
Human   926 -EADQTT--------------LERKT-----LRRAMY---------------------------- 942

  Fly  1203 SRNTNSSHRLSGLSTLTATSESSSISGDVLSRSVLATSCSSYAESSVDGGDLATAAPEPRVQSWQ 1267
                                                                             
Human   943 ----------------------------------------------------------------- 942

  Fly  1268 PPQHVTHHQPLSRNASSPPAMEVANPDVKKSEEARRSNTSSESPLDDHVRGSFQQFLRRMSMRRS 1332
                                          |.||:       :.::|                  
Human   943 ------------------------------SREAK-------AQMED------------------ 952

  Fly  1333 NKPKNHHHPLSATNSILSISEESPPVVHFPASILATDGNKNETQSEEKPKKCVNIDSKETTINCD 1397
                                                   ::|.:.||:.:              |
Human   953 ---------------------------------------EDEEEEEEEDE--------------D 964

  Fly  1398 DNCYSASDKELRANVTSSPADQEQHNERHVLAEVAGESGRESMPLARLAIDTERKYGKISDDIYL 1462
            ||..:.    :|.                          |..||....                .
Human   965 DNMSTV----MRL--------------------------RTKMPWKTC----------------W 983

  Fly  1463 MYIRAAGLPIITIFFITALIWQCLRVYTDIWLQQWSNVHGRVASKGHVVLHPSEQDHEVTYYFRM 1527
            .|:.:.|..::.:...:.|:...:.|..|.||..|::.:. :.:.|..         :.|||   
Human   984 RYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTSEYS-INNTGKA---------DQTYY--- 1035

  Fly  1528 YAAISCVC---IIMALVSTPAGQYAGCNARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDM 1589
            .|..|.:|   |.:.||::...::.|..|.:|||..||..|:...:.||..||||.|:||||.|.
Human  1036 VAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGPIRFFDTTPLGLILNRFSADT 1100

  Fly  1590 AVIDKKIAATGQRLLQFTLLCLSAILINVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIEN 1654
            .:||:.|..|.:.|.:.||||||||.:....||..||..||:..|:|.|||::|.::::||.:::
Human  1101 NIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALLPLGVAFYFIQKYFRVASKDLQELDD 1165

  Fly  1655 ATNSPVISHLSETIQGVTTIRAFNQQTRFTEILFKRLEANTIAYALLNTSHRWLGVSLDYLGGCI 1719
            :|..|::.|.|||.:|:||||||..:|||.:.:.:..:.|.|||..|:.::|||.|..||||.||
Human  1166 STQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLELTDTNNIAYLFLSAANRWLEVRTDYLGACI 1230

  Fly  1720 VFVATVTALTAASVSCRRHYEATTSPSASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVP 1784
            |..|::.:::.:|.|                                    .||||.:.|.|.:.
Human  1231 VLTASIASISGSSNS------------------------------------GLVGLGLLYALTIT 1259

  Fly  1785 IYLNWVVKLLADMEMYAGSVERIAHYAQGQDADADADADADADVDADLDHEPSSNEDVSAEVDRS 1849
            .||||||:.|||:|:..|:|:::                               |..::.|.:. 
Human  1260 NYLNWVVRNLADLEVQMGAVKKV-------------------------------NSFLTMESEN- 1292

  Fly  1850 SQSDAGDKVYPGATTAAGDVDEDGDQQRIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDG 1914
                     |.|.                                                    
Human  1293 ---------YEGT---------------------------------------------------- 1296

  Fly  1915 NHLNFHHPPATAGDKVEQATTKTSVIKDKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQR 1979
                                          :.|.|                      ||..|||.
Human  1297 ------------------------------MDPSQ----------------------VPEHWPQE 1309

  Fly  1980 GDIHFDNVSLRYEGQKQNVISNLTLKIPAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDD 2044
            |:|...::.:|||...:.|:.::...|..||::|||||||||||||.|:.|.::....|.|.||.
Human  1310 GEIKIHDLCVRYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDG 1374

  Fly  2045 VDIQRIRPDELRTRLSIIPQDVHLFNATIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGL 2109
            :||.::....||:|||||.||..||:.:||.||||.....|.:||..||:||||..|.. ||.||
Human  1375 IDISKLPLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKS-LPGGL 1438

  Fly  2110 DTVICDGGLNLSAGHRQLLCLARAILRGSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITI 2174
            |.|:.:||.|.|.|.|||.|||||.:|.|..|::||||:.:|.:||:.|.|....||..||::||
Human  1439 DAVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTI 1503

  Fly  2175 AHRLTTILDYDRLIVLDQGRIVE-DGNPRELQQLEG 2209
            |||:::|:|...::|..:|.:|| |..|..|....|
Human  1504 AHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNG 1539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
ABCC9NP_005682.2 SunT 222..1541 CDD:331423 514/2011 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56521
Inparanoid 1 1.050 770 1.000 Inparanoid score I530
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24223
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.