DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sur and abcc6b.2

Sequence 1:NP_001334732.1 Gene:Sur FlyBaseID:FBgn0028675 Length:2223 Species:Drosophila melanogaster
Sequence 2:XP_003198194.2 Gene:abcc6b.2 ZFINID:ZDB-GENE-110208-2 Length:1502 Species:Danio rerio

Alignment Length:2228 Identity:514/2229 (23%)
Similarity:822/2229 (37%) Gaps:807/2229 (36%)


  Fly    37 VFTFFSIFLLLFGLMFVCSRYKKCHKTLLTFHNGRAAISLLLLALNSFDLARIFLPHQNVRNLNR 101
            :..:|..|.|.....|.|...|       .::|||.:||.|..|  ...||........:..:..
Zfish    35 ILVWFPCFYLWICAPFYCLYLK-------FYYNGRISISSLCCA--KMGLALCLASIGFLETVYL 90

  Fly   102 LFQSSPRDLNYLVVIGSGELWNALFSTLLTLMLMLYHRMVERKKATVFLY-------------AS 153
            |.:.| ||:.:|:|.....:..:|  |::.:|||::...:...:::|||:             ..
Zfish    91 LVERS-RDIEHLMVFLLSPIIRSL--TMILVMLMIHLERLRGFRSSVFLFLFWMLSVVCSLVPLR 152

  Fly   154 TAVEALTFALLSNELFELVRYEDFLELQTCLVAMSAMCMVSLAMLDGLTVYKECYHDDYLDDYGK 218
            ..::|......|.:......:..|..||...:.:|                  |:.|...|....
Zfish   153 ANIQANIKEGFSADPMRFAAFFTFFSLQLAQLILS------------------CFADQRPDTLKP 199

  Fly   219 IGYKHSM----ATFYSKSCFWWLTPLLWLGYKEPLELEDLGQMKLEDSA-------RSHYDHFLY 272
            :..|:..    |:|.||..|||...|:..||:.||:.|||..::.||::       ...:.....
Zfish   200 VYVKNPCPVEDASFLSKLLFWWYGRLVVKGYRSPLKAEDLWSLREEDTSEKIICDLEKEWAKQWA 264

  Fly   273 IYTEKKKKSNSSPSLWYCYIKNSWQMF-------ALGGIL-----------KLAGDLFALIGPLA 319
            ...:||...|.:.:|.:.......|:|       ..|.:|           .|.|.||     |.
Zfish   265 KLQQKKSSLNEAQTLGFKLSSCVKQLFRKLFKEQCTGFVLFRTLAKIFSPYFLTGTLF-----LV 324

  Fly   320 IQKIVEYIEQLYAQASEPPAKSPGNEVANVLLSTSRILGTEFDEVFGTNIDKVRIYSSTWSDLLA 384
            ||..:.:                  .:..||   |.:||...||           .:..|     
Zfish   325 IQDALMF------------------SIPQVL---SLLLGYVRDE-----------DAPLW----- 352

  Fly   385 NGWCIAWIVLLAAITQGALSQASTHILNMTGIRIKTSLQGLIYRKSLLLNADGGCDSSDSAGQVQ 449
            .|:..|:.:.|.:..|...:....:.....|:|:||::.||:|||||::|         ||.:..
Zfish   353 KGYLFAFSLFLLSCLQSLFNHQYMYTCLTVGMRVKTAVMGLVYRKSLVIN---------SAARKT 408

  Fly   450 STSSTSDEKQKNDDSMATPEHVDNPSEPNISHDIGSITNHMTEDTRNIMEFFLIIHYAWAIPFKI 514
            .|                               :|.|.|.::.||:.:::|.:..:..|..|.:|
Zfish   409 CT-------------------------------VGEIVNLVSADTQKLVDFVMYFNALWLAPIEI 442

  Fly   515 AVVIYLLYMNLGISAVIGSIACIVIMTPLQFFIGNAMSKNAEVIAGYTDERLKRIHDTLVGIKVI 579
            |:.::.|:.:||.|.:.| |..::::.||..||....||..||...:.|||:|.:::.|.|||::
Zfish   443 ALCLFFLWQHLGPSTLAG-ITTVILIFPLNGFIAKMRSKLQEVQMKHKDERIKLMNEILSGIKIL 506

  Fly   580 KLNAWDEVFLKKIQEARRKELKYLNKDATFWTLMAVLTHIATVLITFVTLGVYVWLHRDQEFDLN 644
            |..||::.|.:::...|.|||..|.|....:::.....:.:|:||.|...||||.:  |.:..|:
Zfish   507 KFYAWEKAFRERVLGYREKELNALKKSQILYSVSIASFNSSTLLIAFAMFGVYVLI--DDKHVLD 569

  Fly   645 ASRLFSSLALFQQLTVPLLIFPITVPIIIAARVSTRRLERFLKSSEIQKQFEGIRNMARILSKSD 709
            |.::|.|:||...|..||...||.:...:...||.:||..||...|::                 
Zfish   570 AQKIFVSMALINILKAPLSQLPIAMSTTMQVVVSLKRLGTFLDQDELK----------------- 617

  Fly   710 ASLDMYETQEKSNMTMRTAQAENRLNEKRLAQKSQTPELATNSTPLLQNAEESAEDISPSTVQEL 774
              ||                                                        :||.:
Zfish   618 --LD--------------------------------------------------------SVQRV 624

  Fly   775 GHNKLVQQRRELLRNTPYVAIRPPKMRGSVMERPVEFSVIRARNTDSWRRDSLLLKMPDDIAVSI 839
            .:|                                                      |:..:|.|
Zfish   625 PYN------------------------------------------------------PNIESVVI 635

  Fly   840 NDGLFTWQPQSQMPVVQLHVPGIIVPKGKLTIVVGKNGSGKTSLLSALLMEMPLLAGNMFWHKTC 904
            |:|.|:|...|...:.:::|.   |.:|.|..|||..||||:|||||:|.||...:|    |.|.
Zfish   636 NNGTFSWSKDSTPCLRRINVK---VQRGSLVAVVGHVGSGKSSLLSAMLGEMEKKSG----HITI 693

  Fly   905 T--ISYVSQQPWLLNDTIRENILFGESFRPKRYDFVLEACALKPDIELMPRGDLSIIGERGINIS 967
            |  :.||.||.|:.|.|:::|||||...:...|..|||||||.||:|::|..|.:.|||:|:|:|
Zfish   694 TGSVGYVPQQAWIQNATLKDNILFGCEKKDSLYQKVLEACALLPDLEILPARDATEIGEKGLNLS 758

  Fly   968 GGQRQRIAIARAIYSSANVVIMDDPLASLDNEVGEHIFQHCIREMLQKSNRTFILVTQQLHRIKE 1032
            |||:||:::|||:|.::::.::||||:::|..||:|||:..|.......|:|.:|||..|..:.:
Zfish   759 GGQKQRVSLARAVYRNSDIYLLDDPLSAVDAHVGQHIFEKVIGPNGSLKNKTRVLVTHGLSFLPQ 823

  Fly  1033 AEYLIAIKDGRVEACGSYADIELMQPRITAEWNAIIAMAKAKNDNPSQNPGEKTAGERWKLLKNV 1097
            |:.::.:.||.::..||||::                                            
Zfish   824 ADLILVMADGEIKEMGSYAEL-------------------------------------------- 844

  Fly  1098 SKLGLQRSISVTMDANVACHADAIDGSGCISVANMQSNVVEEDDQVSVSYPIGNASCGGFNLQRK 1162
                |.|                             .|...|....|||             :||
Zfish   845 ----LSR-----------------------------KNAFAELKAFSVS-------------ERK 863

  Fly  1163 RSSIYGSRHLMYDVPLPIDECQGDDVIMRPRRRHTLGRRGSRNTNSSHRLSGLSTLTATSESSSI 1227
            .|:                               ||  :|:|.:.|...:...||          
Zfish   864 ESA-------------------------------TL--KGTRKSVSFLSIKDFST---------- 885

  Fly  1228 SGDVLSRSVLATSCSSYAESSVDGGDLATAAPEPRVQSWQPPQHVTHHQPLSRNASSPPAMEVAN 1292
              |::.                  |||.:|:    :|:.:              |.|.|.:....
Zfish   886 --DLIR------------------GDLGSAS----IQTME--------------AISDPKLNQDR 912

  Fly  1293 PDVKKSEEARRSNTSSESPLDDHVRGSFQQFLRRMSMRRSNKPKNHHHPLSATNSILSISEESPP 1357
            .:|.:..:|.:::|                                                   
Zfish   913 DEVGRLTQADKAHT--------------------------------------------------- 926

  Fly  1358 VVHFPASILATDGNKNETQSEEKPKKCVNIDSKETTINCDDNCYSASDKELRANVTSSPADQEQH 1422
                                                                             
Zfish   927 ----------------------------------------------------------------- 926

  Fly  1423 NERHVLAEVAGESGRESMPLARLAIDTERKYGKISDDIYLMYIRAAGLP-IITIFFITALIWQCL 1486
                                           |::..::|:.|.|..||. ||.|.|:.| ..|..
Zfish   927 -------------------------------GRVKLEMYVEYFRTIGLAFIIPIIFLYA-FQQVA 959

  Fly  1487 RVYTDIWLQQWSNVHGRVASKGHVVLHPSEQDHEVTYYFRMYAAISCVCIIMALVSTPAGQYAGC 1551
            .:..:.||..|::         ..|::.::.:.::.  ..:|.|:.....|....:|.|....|.
Zfish   960 SLAYNYWLSLWAD---------DPVINGTQVNTDLK--LGVYGALGFAQGIAIFGTTVAISLGGI 1013

  Fly  1552 NARRNLHDKLLQTILHKTLHFFQVTPLGRIVNRFSNDMAVIDKKIAATGQRLLQFTLLCLSAILI 1616
            .|.|.||..||..:||..:.||:.||.|.::||||.::..||..|....:.:|.:....|...:|
Zfish  1014 IASRQLHLDLLNNVLHSPMSFFESTPSGNLLNRFSKEIDAIDCMIPHGLKIMLGYVFKLLEVCII 1078

  Fly  1617 NVTITPWILVLTLPICGAYYLIQKFYRCSARELQRIENATNSPVISHLSETIQGVTTIRAFNQQT 1681
            .:..||:..|:.||:...|..||.||..::.:|:|:|:.:.||:.:|.:||:||.:.||||.:|.
Zfish  1079 VLMATPFAGVIILPLTLLYAFIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQP 1143

  Fly  1682 RFTEILFKRLEANTIAYALLNTSHRWLGVSLDYLGGCIVFVATVTALTAASVSCRRHYEATTSPS 1746
            ||......|::.|..:|.....:.|||.|:|::||..:|..|.:.::..         .||.||.
Zfish  1144 RFILQANCRVDLNQTSYFPRFVASRWLAVNLEFLGNLLVLAAAILSVMG---------RATLSPG 1199

  Fly  1747 ASASPSPFETYAVTKSPSELRPSPSLVGLAINYTLLVPIYLNWVVKLLADMEMYAGSVERIAHYA 1811
            .                         ||||::::|.|...|:|:|:...|:|....||||:..||
Zfish  1200 T-------------------------VGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVKEYA 1239

  Fly  1812 QGQDADADADADADADVDADLDHEPSSNEDVSAEVDRSSQSDAGDKVYPGATTAAGDVDEDGDQQ 1876
            :                                                                
Zfish  1240 E---------------------------------------------------------------- 1240

  Fly  1877 RIGGARGGGGDCGYRQGHENGAEANADKLNAGNVTGDGNHLNFHHPPATAGDKVEQATTKTSVIK 1941
                                                            ||               
Zfish  1241 ------------------------------------------------TA--------------- 1242

  Fly  1942 DKQLPPQQDDKDKKVVLPNEPARKLERYQSVPISWPQRGDIHFDNVSLRYEGQKQNVISNLTLKI 2006
             |:.|...:|                  ..:|..||:.|.|.|....|:|.......:..::|.:
Zfish  1243 -KEAPWTFED------------------SPLPSDWPRSGSIGFQAYGLQYRKGLDWALKEISLSV 1288

  Fly  2007 PAGQRIGICGRTGSGKSSLGLSLFGVLQTTRGHIYIDDVDIQRIRPDELRTRLSIIPQDVHLFNA 2071
            ...:::||.||||:|||||.|.:|.:|:..:|.|:||.::|..|...|||:|::|||||..||:.
Zfish  1289 NEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSG 1353

  Fly  2072 TIRENLDPHGYFQDLQLWNCLELAQLKEFVNGHLPLGLDTVICDGGLNLSAGHRQLLCLARAILR 2136
            ::|.||||...:.|.::|..||||.||.||: .||..|:....:||.|||.|.|||:|||||:||
Zfish  1354 SLRINLDPFDRYTDEEVWRSLELAHLKTFVS-DLPDKLNHECSEGGENLSLGQRQLICLARALLR 1417

  Fly  2137 GSVCLVLDEATSVLDSSTESALLKAADLAFRGRTIITIAHRLTTILDYDRLIVLDQGRIVEDGNP 2201
            .:..|||||||:.:|..|::.:.......|...|::||||||.||:||.|:||:|:|.|.|..:|
Zfish  1418 KTKILVLDEATAAVDLKTDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGNITEIDSP 1482

  Fly  2202 RELQQLEGSVFRGLLEKG 2219
            ..|....|..:|...|.|
Zfish  1483 SNLISQHGQFYRMCREAG 1500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SurNP_001334732.1 None
abcc6b.2XP_003198194.2 MRP_assoc_pro 5..1501 CDD:188098 514/2229 (23%)
ABC_membrane 320..587 CDD:294371 91/352 (26%)
ABCC_MRP_domain1 633..834 CDD:213217 90/208 (43%)
ABC_membrane 950..1215 CDD:279056 85/311 (27%)
ABCC_MRP_domain2 1262..1482 CDD:213211 99/221 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138195at2759
OrthoFinder 1 1.000 FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.