DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and AT1G59860

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana

Alignment Length:107 Identity:22/108 (20%)
Similarity:52/108 (48%) Gaps:16/108 (15%)


  Fly    84 RGTFKVVLDVHHFQI-------SELTVKAKNSDTVCVEGKQADDRAEKGQLCITRE-----FTRS 136
            |..:|...:.|.|:.       .|:.|:.::...:.:.|::..::.||.......|     |:|.
plant    47 RVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGGFSRK 111

  Fly   137 YKLPRHYDATQARATFSADGILMITVPAPPKLDDVEREIEIE 178
            ::||.:....|.:|:.. :|:|.:||   ||::..:::.:::
plant   112 FRLPENVKMDQVKASME-NGVLTVTV---PKVETNKKKAQVK 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 19/88 (22%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 21/95 (22%)
IbpA <48..152 CDD:223149 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.