DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and AT5G51440

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_199957.1 Gene:AT5G51440 AraportID:AT5G51440 Length:210 Species:Arabidopsis thaliana

Alignment Length:188 Identity:44/189 (23%)
Similarity:70/189 (37%) Gaps:52/189 (28%)


  Fly     8 DWEHDHEHGHHHWQPPRRHWSTGESKCRQRH--YYLSHDLDVCARDFHLR-----MDDSAWCHGS 65
            ::|...:..||    ..||.|        ||  .:.||.||.......|.     ||.       
plant    44 NYEDGVDRNHH----SNRHVS--------RHGGDFFSHILDPFTPTRSLSQMLNFMDQ------- 89

  Fly    66 CLVGRVVIETGTE---PDSLGRG-TFKVVLDVHHFQI-----SELTVK-AKNSDTVCVEG----K 116
              |..:.:.:.|.   ...:.|| ..|...|..|.:|     |...|| |...:|:.:.|    :
plant    90 --VSEIPLVSATRGMGASGVRRGWNVKEKDDALHLRIDMPGLSREDVKLALEQNTLVIRGEGETE 152

  Fly   117 QADDRAEKGQLCITREFTRSYKLP-RHYDATQARATFSADGILMITVPAPPKLDDVER 173
            :.:|.:..|     |.||...:|| :.|...:.:|... :|:|.:.:   ||:.:.||
plant   153 EGEDVSGDG-----RRFTSRIELPEKVYKTDEIKAEMK-NGVLKVVI---PKIKEDER 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 21/87 (24%)
AT5G51440NP_199957.1 IbpA <112..210 CDD:223149 25/100 (25%)
ACD_sHsps-like 112..195 CDD:107221 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.